SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000018431 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000018431
Domain Number 1 Region: 222-479
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.08e-83
Family Nuclear receptor ligand-binding domain 0.000000000902
Further Details:      
 
Domain Number 2 Region: 153-234
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.89e-31
Family Nuclear receptor 0.00000886
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000018431   Gene: ENSSHAG00000015645   Transcript: ENSSHAT00000018584
Sequence length 483
Comment pep:novel scaffold:DEVIL7.0:GL834654.1:1868929:1982962:1 gene:ENSSHAG00000015645 transcript:ENSSHAT00000018584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLHLLTSLSGGALPWFGGDRRRLADFSTQVNSTSLNSPTGRGSMAAPSLHPSIGPGLGS
SLGSSSQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFGTGSPQLNSPMN
PVSSTEDIKPPLGLNGVLKVPAHPSGTMASFTKHICAICGDRSSGKHYGVYSCEGCKGFF
KRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENE
VESTSSANEDMPVEKILEAELAVEPKTETYIEANMGLNPNSPNDPVTNICQAADKQLFTL
VEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHS
AGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYAS
LEAYCKHKYPDQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPH
QMT
Download sequence
Identical sequences G3WSM6
ENSSHAP00000018431 ENSSHAP00000018431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]