SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000018586 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000018586
Domain Number 1 Region: 12-241
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.62e-77
Family BAR domain 0.0000000207
Further Details:      
 
Domain Number 2 Region: 289-344
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000118
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000018586   Gene: ENSSHAG00000015778   Transcript: ENSSHAT00000018740
Sequence length 344
Comment pep:novel scaffold:DEVIL7.0:GL864810.1:1915228:1928524:1 gene:ENSSHAG00000015778 transcript:ENSSHAT00000018740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAAGLKKQFYKATQLVSEKVGGAEGTKLDDDFKEMEKKVDVTSKAVAEVLTKTIEYLQP
NPASRAKLTMLNTVSKIRGQLKNPGYPQSEGLLGECMIRYGKELGEDSNFGDALLDAGES
MKRLAEVKDSLDIEVKRNFIDLLQNLCDKDLKEIQHHLKKLEGRRLDFDYKKKRQGKISD
EELRQAMEKFEGSKELAETSMHNLLESDIVQVSQLSALVDAQLDYHKQAVQILDELADKL
KRRMQEASSRCKREYQPKSREPFDFGEPAQSNGGVPCASDPKITASSSLPSSDKPKPIRT
PKSRMPSRDQPSCKALYDFEPENDGELGFRAGDIITLTNQIDEN
Download sequence
Identical sequences G3WT31
ENSSHAP00000018586 ENSSHAP00000018586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]