SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000018940 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000018940
Domain Number 1 Region: 217-230,380-617
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.49e-63
Family Nuclear receptor ligand-binding domain 0.0000628
Further Details:      
 
Domain Number 2 Region: 147-230
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.76e-32
Family Nuclear receptor 0.0000738
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000018940   Gene: ENSSHAG00000016078   Transcript: ENSSHAT00000019096
Sequence length 629
Comment pep:novel scaffold:DEVIL7.0:GL841598.1:2020287:2108279:-1 gene:ENSSHAG00000016078 transcript:ENSSHAT00000019096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATNMEVLAQQIVETQQVAEVQTVQTSLSESPVMTSPSQRIQIISTDSSVASPQRIQIVT
DQQTGQKIQIVTAVDSSVSPKQQFILTSPDGTGTGKVILASPETSSAKQLIFTTTDNLVP
GRIQIVTDSASVERLLGKADVQRPQVVEYCVVCGDKASGRHYGAVSCEGCKGFFKRSVRK
NLTYSCRSNQDCIINKHHRNRCQFCRLKKCLEMGMKMESVQSERKPFDVQREKPTNCAAS
TEKIYIRKDLRSPLIATPTFVADKDGTRQTGLLDPGMLVNIQQPLIRDDGTVLLAADSKA
ETSQGALGTLANVVTSLANLNESLNNGDPSEIQQEDQSASEITRAFDTLAKALNTTDGSS
PPNLADGMDPTGGGNIHVISRDQSTPIIEVEGPLLTDTHVTFKLTMPSPMPEYLNVHYIC
ESASRLLFLSMHWARSIPAFQALGQDCNTSLVRACWNELFTLGLAQCSQVMSLSTILAAI
VNHLQNSIQEDKLSGDRIKQVMEHIWKLQEFCNSMAKLDIDGYEYAYLKAIVLFSPDHPG
LTSTSQIEKFQEKAQMELQDYVQKTYSEDTYRLARILVRLPALRLMSSSITEELFFTGLI
GNVSIDSIIPYILKMETAEYNGQITGTNL
Download sequence
Identical sequences G3WU35
ENSSHAP00000018940 XP_003762511.1.9362 ENSSHAP00000018940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]