SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000019203 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000019203
Domain Number 1 Region: 192-467
Classification Level Classification E-value
Superfamily Mitochondrial carrier 2.88e-80
Family Mitochondrial carrier 0.0000396
Further Details:      
 
Domain Number 2 Region: 10-186
Classification Level Classification E-value
Superfamily EF-hand 1.67e-39
Family Calmodulin-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000019203   Gene: ENSSHAG00000016306   Transcript: ENSSHAT00000019359
Sequence length 477
Comment pep:novel scaffold:DEVIL7.0:GL856988.1:2113887:2152632:-1 gene:ENSSHAG00000016306 transcript:ENSSHAT00000019359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRWVRGFVLPEAVCQETDTPNRFENLFQKLDRNGDGKVDISELQEGLKNLGIPLGRDAE
EKIFNIGDVNRDGRLDFEEFMKYLKDHEKKMKLAFKSLDKNNDGIIDALEVVQSLKILGI
DISEQQAKKILQSIDADGTMSVDWNEWRDYFLFNPAENIEEIIRFWKHSTGIDIGDSLSI
PDDFTEEEKKTGQWWRQLLAGGIAGAVSRTSTAPLDRMKVMMQVYGSKSNKMSLLGGFKQ
MVKEGGIRSLWRGNGVNVIKIAPETAVKFWAYEQYKKLLTKDGAKLGNTERFISGSMAGA
TAQTFIYPMEVLKTRLAVGKTGQYSGIYDCAKKILKYEGVKAFYKGYIPNFLGIIPYAGI
DLAVYELLKNYWLEHHAEDSVNPGVFVLLGCGTLSSTCGQLASYPLALVRTRMQAQAMVE
GGPQLSMIGLFKRIITQQGILGLYSGITPNFMKVLPAVSISYVVYEKMKESLGIASK
Download sequence
Identical sequences G3WUU8
ENSSHAP00000019203 ENSSHAP00000019203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]