SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000019531 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000019531
Domain Number 1 Region: 237-290
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000164
Family EGF-type module 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000019531   Gene: ENSSHAG00000016586   Transcript: ENSSHAT00000019688
Sequence length 710
Comment pep:novel scaffold:DEVIL7.0:GL864734.1:2240100:2370275:-1 gene:ENSSHAG00000016586 transcript:ENSSHAT00000019688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VETGASDMSEGAAESCPSPSSELSPDPSVDGLPTAEAMSRAQAEDGGEGAIVGLAIPCCV
CLETERLRGCLNSEKICIVPILACLVSLCLCIAGLKWVFVDKIFEYDTPTHLDPGRIGQD
PITAVDPTAASTIWDPSEVYPSPSFPGAHREAKGQVQGVTMQGGSSQVPSDPLAPPSPQN
PSLAFSLLPSAAPSFPPPIQDSEGRAPMTASQAPTTETNLQSAPKVSTSTSTAGTSHLVK
CAEKDKTFCVNGGECFIVKDPSNPSRYSCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAE
ELYQKRVLTITGICIALLVVGIMCVVAYCKTKKQRKKLHDRLRQSLRSERNNMVNMANGP
HHPNPPPENVQLVNQYVSKNIISSEHVIERETETSFSASHCTSPAHHSMAATQTPSHSWS
NGHTESIVSESHSVLVISSIENSRHTSPAGGPRGRLNGMGGPRDCNSFLRHARETPDSYR
DSPHSERYVSAMTTPARMSPVEFYMPSSPKSPPSEISPPISSLTVSMPSVAVSPLVEEER
PLLLVTPPRLREKKYDHHPQQFNSFHHNPVHESNSLPPSPLRIVEDEEYETTQEYETTQE
YEPAQEPTKKLVNSRRAKRTKPDGHISNRLEMDSDTSSENSNSESETEDERIGENTPFLS
IQTPMAAGLESAPAFRLADSRTNPTSRYSTQEEFQARLSSVIANQDPIAV
Download sequence
Identical sequences G3WVS6
ENSSHAP00000019531 ENSSHAP00000019531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]