SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000019607 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000019607
Domain Number 1 Region: 142-386
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.02e-66
Family Nuclear receptor ligand-binding domain 0.00000000025
Further Details:      
 
Domain Number 2 Region: 25-102
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.12e-25
Family Nuclear receptor 0.0000166
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000019607   Gene: ENSSHAG00000016645   Transcript: ENSSHAT00000019764
Sequence length 388
Comment pep:novel scaffold:DEVIL7.0:GL867574.1:2267999:2353019:-1 gene:ENSSHAG00000016645 transcript:ENSSHAT00000019764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QILFSLRLETTRDHVLPIDYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQ
KYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASGSGSP
HEDPAQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQ
LVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFN
EYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVEGLKNQKFFDELR
MNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDF
PEMMAEIISVQVPKILSGKVKPIYFHTQ
Download sequence
Identical sequences G3WW02
ENSSHAP00000019607 ENSSHAP00000019607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]