SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000019635 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000019635
Domain Number 1 Region: 584-610,641-883
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.02e-59
Family Nuclear receptor ligand-binding domain 0.00000000303
Further Details:      
 
Domain Number 2 Region: 531-609
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.73e-23
Family Nuclear receptor 0.0000286
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000019635   Gene: ENSSHAG00000016670   Transcript: ENSSHAT00000019792
Sequence length 903
Comment pep:novel scaffold:DEVIL7.0:GL849676.1:2280984:2361927:-1 gene:ENSSHAG00000016670 transcript:ENSSHAT00000019792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTELKAKDPRTPHVADGAPSPSQVESPLLGHPDPDPFQSIQNSENPPVVTALPISLDGLL
FARSSDEEEPPDRKEEGERVLPEVDCAYPVAAGSGGGGGGGRSSSVRAPGKDSGLLDSVL
DTLLASPGPGHGHASPPACVATPWCLFGTELPEDPGAAPSSQGALPPLMNRLPGKEGEVS
GAGAAHKVPPGGPPSSRPPLEDSPPWPQAYANPSPHQAAVLKEGLPQVYPPYLNYLSSGW
GRSGWSGGGGGGGGVELVRNPAVPKITVATSRRPLDPITREGVGAVLEIAFPPLLPLSYA
PHLAFRSTTSLSLGNLGGRVRKRPQGFGGKERIFEDCGAFLCFKLGAFQFPIRIELMRRA
THQKRKQKNIMLKRPAGPLVYLNWSNKTTKIPSYMSPESTFKNVSFMYFVSVGYISVNQM
GAIAQILKSIRLFLCVLQFYKTSTEPLLKKKRERLGFQLTASGLKVYYYGRCLSQASCLL
HSSVGLQSARIIWTFVLCLKINTTQKFKKLIQRPDTEASQSPQYGFESLPQKICLICGDE
ASGCHYGVLTCGSCKVFFKRAMEGQHNYLCAGRNDCIVDKIRRKNCPACRLRKCCQAGMV
LGGRKFKKFNKVRVMRALDAVALPQPVGLPNESQALTQRITFSPNQEVQLISPLINLLLS
IEPDVIYAGYDNTKPETSSSLLTCLNQLAERQLLSVVKWSKSLPGFRNLHIDDQITLIQY
SWMSLMVFGLGWRSYKHVNSQMLYFAPDLILNDIARQRMKESSFYSLCLTMWQIPQEFMK
LQVTQEEFLCMKALLLLNTIPLEGLRNQNQFDEMRSSYIRELIKAIGLRQKGVVASSQRF
YQLTRFMDSLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLF
HKK
Download sequence
Identical sequences G3WW30
ENSSHAP00000019635 ENSSHAP00000019635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]