SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000020160 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000020160
Domain Number 1 Region: 805-995
Classification Level Classification E-value
Superfamily Nucleotide cyclase 9.73e-63
Family Adenylyl and guanylyl cyclase catalytic domain 0.00011
Further Details:      
 
Domain Number 2 Region: 502-769
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.56e-47
Family Protein kinases, catalytic subunit 0.00037
Further Details:      
 
Domain Number 3 Region: 39-420
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.28e-46
Family L-arabinose binding protein-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000020160   Gene: ENSSHAG00000017101   Transcript: ENSSHAT00000020320
Sequence length 1068
Comment pep:novel scaffold:DEVIL7.0:GL861612.1:2509569:2617053:1 gene:ENSSHAG00000017101 transcript:ENSSHAT00000020320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLVLGLVLWPLLFYFQGWGWILPENNFCGKGLYGISVLMMNNSAFPEPLKNLEIAMNKS
MDMVKNQLKVLKLDTNINVSIQYQRSLTPIYKINDCSSSTCEGLSVLKTIKENNTVGCAL
LGPSCTYSTYQMYLDTVLDFPMISSGSFGLSCDHKENLTRLMFPARKLTYFLVDFWETND
LPFKTVSWKTAYIFKNTNYSEECFWYLNALEAGVSYFSQKLQFKDVLRSDEEFYRVLKNK
NRKSNVIIMCGTPKSVNVLKDNFESDEDIIIVLVDLFNNQYFENTTSAPYMKNVLVVTLN
STKSSLSNLLNISLVKDDFVLAHMDGIMLFGHMVQQALQNTSNAYFSHGFRNLTFQGTLG
PVTLDEWGDIDNNVTLLYTSADTCEYKYLLRYDTHLNKTVHFEDRPSLTWKNQKLPRGEP
GKNPEILMIAVFALTGTVIFILFISLLVLRKNRKNNELRQKKWSHIPTEEILLLETNETS
PVSLKIDEDKRRDTVTRLRQGKYDKKVVILKDLKHNDDNFTERQKIDLNKLLQIDYYNLT
KFYGTVKIDAMIFGVIEYCERGSLREVLNDTISYPDGTFMDWEFKISVMYDIAKGMSYLH
SSKTEVHGRLKSTNCVVDSRMVVKITDFGCNSILPSKKDLWMAPEHLRAANVSQKGDVYS
YGIITQEIILRRETFYTLRCRDQKEKIYRVENCKDSKPFRPDLYLETSDEKELEVYLLVK
SCWEEDPEKRPDFKKIESTLAKLFSNFHSQNSESYMDTLIRRLQLYSRNLEHLVEERTKL
YKAERDRADRLNFMLLPRLVVKSLKEKGFVEPELYEEVTIYFSDIVGFTTICKYSTPMEV
VDMLNDVYKSFDHILDHHDVYKVETIGDAYMVASGLPKRNGNRHAVDIAKMALDILSFMG
SFELQHLPGLPVWIRIGVHSGPCAAGVVGIKMPRYCLFGDSVNTASRMESTGLPLRIHVS
GSTIAILKRTECQFLYEVRGETYLKGKGTETTYWLTGVKDQEYTLPTPPSAENQQHLQAE
FSNMITEALQKRQAQGLSNQKLRRVASYKKGTLEYLQLNTTDDNNTYF
Download sequence
Identical sequences G3WXK5
ENSSHAP00000020160 ENSSHAP00000020160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]