SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000020223 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000020223
Domain Number 1 Region: 216-411
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.19e-55
Family Nuclear receptor ligand-binding domain 0.00000000792
Further Details:      
 
Domain Number 2 Region: 107-193
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.75e-28
Family Nuclear receptor 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000020223   Gene: ENSSHAG00000017152   Transcript: ENSSHAT00000020383
Sequence length 422
Comment pep:novel scaffold:DEVIL7.0:GL864893.1:2537779:2547483:1 gene:ENSSHAG00000017152 transcript:ENSSHAT00000020383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSWLRPPVPDITPDSVVELWKAEAQDTKHLWEAESQDVGDSLGKVASNFILGEEARISH
PGGGGSEVGQNTGPVPILFPCSEVHLESTERRPPKRKKGPAPKMLGNEVCSVCGDKASGF
HYNVLSCEGCKGFFRRSVIKGARYTCHSGGHCPMDTYMRRKCQECRLRKCRQAGMREQCV
LSEEQIRLKKLKRQEEEQGQSSAGSPPAPSPPPALPQLSPEQRGMIEKLVAAQQQCNQRS
FSDRLRVTPWPLAPDPQSREARQQRFAHFTELAIMSVQEIVDFAKQLPGFLQLSREDQIA
LLKTSTIEVMLLETSRRYNPGSESITFLKDFSYNRDDFAKAGLQVEFINPIFEFSRAMNE
LQLNDAEFALLIAISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPNVSVSPGVPS
PH
Download sequence
Identical sequences G3WXR8
ENSSHAP00000020223 ENSSHAP00000020223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]