SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000020558 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000020558
Domain Number 1 Region: 1140-1335
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.67e-58
Family BCR-homology GTPase activation domain (BH-domain) 0.0000228
Further Details:      
 
Domain Number 2 Region: 926-1049
Classification Level Classification E-value
Superfamily PH domain-like 7.87e-32
Family Pleckstrin-homology domain (PH domain) 0.000000779
Further Details:      
 
Domain Number 3 Region: 35-160
Classification Level Classification E-value
Superfamily PDZ domain-like 4.6e-20
Family PDZ domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000020558   Gene: ENSSHAG00000017433   Transcript: ENSSHAT00000020722
Sequence length 1940
Comment pep:novel scaffold:DEVIL7.0:GL861682.1:2718258:2809364:1 gene:ENSSHAG00000017433 transcript:ENSSHAT00000020722 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RERERERTREQEGERMRICHVAKNKDGKEQSETVSPSEDETFSWPGPKTVMLKRTSQGFG
FTLRHFIVYPPESAIHISCKDEENGNRGGKQRNRLEPMDTIFVKQVKEGGPAFEAGLCTG
DRIIKVNGESVIGKTYSQVIALIQNSDTTLELSVMPKDEDILQVLQFTKDVTALAYSQDA
YLKGNEAYSGNAHNIPEPPPICYPWLSPSTSGKAQPVEVAPSDSSLSKQPVSPPALAQPG
RAYRMEVQVPPSPPDVAKSNTAVCVCNETVRTVIVPSEKAVDLSSGRNNLTGPSHRTEEV
RYGISEQTSLKTVSRTLSPSSSVPTTHLIHPTPVSRSGEPSGVSVKSGNYGGHSEGISSS
RPQAVDTPSVSTNHYSPNSHQHIDWKNYKTYKEYIDNRRLHMGCRTIQERLDSLRAASQN
TTDYSQVVSNRTPWQTRRRSTSHDRAPQPVQIRQRSVSQERLEDPVLMKYWPRSASQGAL
TSPSVSFRSHRTRSWDYLGGQGDTSEKANSESLVSDSNGDRKQTYKWTGFTEQDDRRGIY
ERSRQQDFHKSLRNSNFTVAPSVLNSDSRRVSGRGVGSGSQFQKASPDLKVLQSNRNFQS
TYGTSLPRGISQDRSPLVKVRSNSLKSPSAYVAKPSFNQNSFVAIRDQRAVNHLCSSNLL
NQQSRLRAESAPDHIVDAGKSPTSSSSKLGLQMNESCSPSDDLEPSIKQNSQEAEIPPSS
SLENKETVVLREKPPSGRQTPQPLRHQSYILAVNDQETSSDTTCWLPNDARREVHIKRIE
ERKASSSSPPGDSLASIPFIDEPTSPSIDHDIAHIPASAVISASTSHVPTIATIPPSLTT
SAPLIRRQLSHDHGSVGPILDGQRNSKTERSKSYDEGLDDYREEAKGSFKHVSSLKGIKV
LDSQKSSEDSGSRKDSSSEVFSDAAKEGWLHFRQLVPDKGKRVGGSIRPWKQMYVVLRGH
SLYLHKDKREQTTPSEEEQPISVNACLIDISYSETKRKNVFRLTTSDCEYLFQAEDRDDM
LAWIKTIQESSNLSEEDTGVTSRDLISRRIKEYSSLMSKADQLPKTPRQSLSIRQTLLGT
KSEPKFQSPHSPKEESERKLLSKAITKDDTSPPKDKGTWRKGIPNIMRKTFEKKPTAVGT
FGVRLDDCPPAHTNRYIPLIVDICCKLVEERGLEYTGIYRVPGNNAAISSMQEELNKGMA
DIDIQDDKWRDLNVISSLLKSFFRKLPEPLFTNDKYADFIEANRKEDPLERLKTLKRLIH
DLPEHHYETLKFLSAHLKTVAENSEKNKMEPRNLAIVFGPTLVRTSEDNMTHMVTHMPDQ
YKIVETLIQHHDWFFTEEGAEEPLTTVQEENTVESQPVPNIDHLLTNIGRTGVSPGDVSD
SATSDSAKSKGSWGSGKDQYSRELLVSSLFAAASRKRKKTKEKAQPSSSEDELDNVFFKK
EIAEQPQSDNNSKEDGSGELKRENDPVRKQRTSISKDNTSKKDLHVMKEEKLAPRKENVV
SGEPLLPPNSKSTKSPTLGYRFTVLKEGPQTPSPGPGALLSTASPLSLERLPGKKSLSLE
TKCSEFLANADSTSGYSTTSSAAYLTTLDSSRLSPEVRSVAESKGEEADDEQSELVSEGR
PVETDSENDFPVFATGFLSEKFFRGKIQEMVKTSRRNSEGSELSCTEGSLTPSLDSRRQL
FSSHKLIERDTLSRKKSARFKSESDGTGDTKNERESSSVTKVFDMKKKGKSTGNLLTPSR
SDSEKHEPTWRIKITDRLKLRLKASADDMFGVGNQKNSSAENAKRKNIRRRHTLGGQRDF
AEISVLNAWKVPEQSGERESELSAVTRLKPKCPAQDLSISDWLARERLRTSTSDLNTGEP
GEYRLENTSITETYKSDGGSSPSTLTLTNRPLLSISPQSPEQINGESFQNVNQNDRPLPV
ANPQKPSLAPGTKSQFHQCL
Download sequence
Identical sequences G3WYQ3
ENSSHAP00000020558 ENSSHAP00000020558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]