SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000020787 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000020787
Domain Number 1 Region: 142-385
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.46e-67
Family Nuclear receptor ligand-binding domain 0.0000149
Further Details:      
 
Domain Number 2 Region: 73-155
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.6e-31
Family Nuclear receptor 0.000087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000020787   Gene: ENSSHAG00000017631   Transcript: ENSSHAT00000020954
Sequence length 393
Comment pep:novel scaffold:DEVIL7.0:GL834477.1:2862587:2885361:1 gene:ENSSHAG00000017631 transcript:ENSSHAT00000020954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMVVGAWRDPQDDVPGNQGTQPSQAPPVQGPPAGAPHTPQTPGQGGPPSTPAQTNQPSQ
QSQAGDKQQQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRNCPI
DQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSGYIS
LLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITDQVA
LLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLK
ALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRFGKL
LLRLPSLRTVSSSVIEQLFFVRLESWSEPARSV
Download sequence
Identical sequences G3WZD2
ENSSHAP00000020787 ENSSHAP00000020787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]