SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000021023 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000021023
Domain Number 1 Region: 218-256
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000108
Family Tudor domain 0.018
Further Details:      
 
Domain Number 2 Region: 173-198
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000644
Family CCCH zinc finger 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000021023   Gene: ENSSHAG00000017828   Transcript: ENSSHAT00000021193
Sequence length 515
Comment pep:novel scaffold:DEVIL7.0:GL834659.1:3016392:3023117:-1 gene:ENSSHAG00000017828 transcript:ENSSHAT00000021193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDENSVEASIQTYHVQLQQVELALGAGLDPTEKADLLQLQADLKQLIELTESSLVSIKKS
KLLATLDPSLGLIESAVRDEAEYLAFQNAISEVTGESEIQGAERATSPERGETEPDKSGH
EEEEEEELSGMKVNAPYYSSWGTLEYHNAMIVGTEQTEDGTAGVRVLYLYPTHKSLKPCP
FFLEGKCRFKENCRFSHGQVVAVDELRPFQEPDLSALHTGSACLAKYDDGIWYPARITDV
DSGYYTVKFDSLLLKETVVEGDGIMPPLRSEDSTLSESDGDDVDDSSYAKVMESETLEKG
AWGPACSSSFAGWEAHTRGIGSKLLAQMGYEFGKGLGKNAEGRVEPIHAVVLPKGKSLDH
CAEILQKRTSGKPNLGKPRKSQAKGNGVKGRPPQRNVFDFLNEKLQGKVARVQEERKVQS
LKRSSKELYHASKSTKRSLSVQLFQILEKVEQTQRDIRSIQEALARNIGRHSVATAQLEE
KLAGAQKELKNLRASPASIQQGQEADTTEGRSSTW
Download sequence
Identical sequences G3X018
ENSSHAP00000021023 ENSSHAP00000021023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]