SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000021056 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000021056
Domain Number 1 Region: 89-386
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.31e-59
Family Nuclear receptor ligand-binding domain 0.0000235
Further Details:      
 
Domain Number 2 Region: 18-104
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.02e-28
Family Nuclear receptor 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000021056   Gene: ENSSHAG00000017854   Transcript: ENSSHAT00000021226
Sequence length 390
Comment pep:novel scaffold:DEVIL7.0:GL856934.1:3043959:3067212:1 gene:ENSSHAG00000017854 transcript:ENSSHAT00000021226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSAPVPNLIPSPLGRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTYVCKSG
NQGGCPVDKTHRNQCRACRLKKCLEVNMNKDAVQHERGPRTSTIRKQVALYFRGHKEENG
AAPHFPSAALPAPAFFTAVTQLEQHNLELAAVSGTPERQTLVGLAQPTPKYPHEVNGAPM
YLYEVATESVCESAARLLFMSIKWAKSVPAFSTLSLQDQLMLLEDAWRELFVLGIAQWAI
PVDANTLLAVSGMNGENTDSQKLSKIISEIQALQEVVARFRQLRLDATEFACLKCIVTFK
AVPTHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPALRSISP
STIEEVFFKKTIGNVPITRLLSDMYKSSDI
Download sequence
Identical sequences G3X051
ENSSHAP00000021056 ENSSHAP00000021056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]