SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000021263 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000021263
Domain Number 1 Region: 3-126
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 4.21e-31
Family PWWP domain 0.00000889
Further Details:      
 
Domain Number 2 Region: 351-430
Classification Level Classification E-value
Superfamily HIV integrase-binding domain 6.54e-30
Family HIV integrase-binding domain 0.00000733
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000021263   Gene: ENSSHAG00000018023   Transcript: ENSSHAT00000021435
Sequence length 535
Comment pep:novel scaffold:DEVIL7.0:GL841569.1:3188299:3214733:-1 gene:ENSSHAG00000018023 transcript:ENSSHAT00000021435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLPIFFFGTHETAFLGPKDIFP
YSENKDKYGKPNKRKGFNEGLWEIDNNPKVKFSSQQASTKQPNASSDVETEEKEISTSKE
DTDHEEKTSNEDVTKTMDITTPKAARRGRKRKAEKQVETEEVGMVTAATTATSVSPKVSP
KRGRPSATEVKVPKPRGRPKMVKPPCPSDNDNVTEEDKNKKKGQDEKQPKKQLKKEEEVQ
KEEDKPRKEPDKKEGKKEVEPKRKTTTKTGFVSTSDSEEEGDDQEGEKKKKRKGGRNFQA
AHRRNIIKGQHEKEAADRKRKQEEQMETESQNKDESKKPEVKKVEKKRETSMDSRLQRIH
AEIKNSLKIDNLDVNRCIEALDELASLQVTMQQAQKHTEMITTLKKIRRFKVSQVIMEKS
TMLYNKFKNMFLVGEGDSVITQVLNKSLAEQRQHEEANKTKEQGKKGPNKKLDKEQTEGS
KTLNGGSDAQDNNQPQHNGESNEDSKDRHEAIMKKKTSSEDREPEKIPKDSTVEN
Download sequence
Identical sequences G3X0Q8
ENSSHAP00000021263 ENSSHAP00000021263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]