SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000021991 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000021991
Domain Number 1 Region: 186-451
Classification Level Classification E-value
Superfamily Mitochondrial carrier 4.32e-75
Family Mitochondrial carrier 0.0000776
Further Details:      
 
Domain Number 2 Region: 29-177
Classification Level Classification E-value
Superfamily EF-hand 7.79e-28
Family Calmodulin-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000021991   Gene: ENSSHAG00000018613   Transcript: ENSSHAT00000022167
Sequence length 454
Comment pep:novel scaffold:DEVIL7.0:GL834651.1:3817819:3829607:1 gene:ENSSHAG00000018613 transcript:ENSSHAT00000022167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCLCLYVPLIGEAQTEFQYFESKGLPTELKSIFKLSVFIPSQEFSTYRQWKQKIVKAGD
KDLDGQLDFEEFVHYLQDHEKKLRLVFKSLDKKNDGRIDAQEIMQSLRDLGVKISEQQAE
KILKSMDKNGTMTIDWNEWRDYHLLHPVENVPEIILYWKHSTIFDVGENLTVPDEFTVEE
RQTGMWWRHLVAGGGAGAVSRTCTAPLDRLKVLMQVHASRSNNMCIVGGFTQMIREGGAK
SLWRGNGINVIKIAPESAIKFMAYEQIKRLVGSDQETLRIHERLVAGSLAGAIAQSSIYP
MEVLKTRMALRKTGQYSGMLDCAKKILSKEGMTAFYKGYIPNMLGIIPYAGIDLAVYETL
KNTWLQRYAVNSADPGVFVLLACGTISSTCGQLASYPLALVRTRMQAQATIEGAPEVTMS
SLFKHILRTEGAFGLYRGLAPNFMKVIPALIAPS
Download sequence
Identical sequences G3X2T6
ENSSHAP00000021991 ENSSHAP00000021991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]