SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000022089 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000022089
Domain Number 1 Region: 54-194
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000082
Family Phosphotyrosine-binding domain (PTB) 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000022089   Gene: ENSSHAG00000018695   Transcript: ENSSHAT00000022266
Sequence length 217
Comment pep:novel scaffold:DEVIL7.0:GL849907.1:3941544:4208012:1 gene:ENSSHAG00000018695 transcript:ENSSHAT00000022266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWQPATERLQHFQTMLKTKLNVLTLRKEPLPTVIFHEPEAIELCTTTPLMKTRTHSGCKV
TYLGKVSTTGMQFLSGCTEKPVIELWKKHTLAREDVFPANALLEIRPFQVWLHHLDLKGE
ATVHMDTFQVARIAYCTADHNVSPNIFAWVYREINDDLSYQMDCHAVECESKLEAKKLAH
AMMEAFKKTFHSMKSDGRIHRNSSSEEVSQELESDDG
Download sequence
Identical sequences G3X334
XP_012401969.1.9362 XP_020826624.1.61212 ENSSHAP00000022089 ENSSHAP00000022089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]