SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000022331 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000022331
Domain Number 1 Region: 20-249
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.36e-70
Family BAR domain 0.00044
Further Details:      
 
Domain Number 2 Region: 242-272,307-364
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000205
Family SH3-domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000022331   Gene: ENSSHAG00000018901   Transcript: ENSSHAT00000022509
Sequence length 365
Comment pep:novel scaffold:DEVIL7.0:GL834651.1:4570941:4582910:-1 gene:ENSSHAG00000018901 transcript:ENSSHAT00000022509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SWLFMNLTEFSFSFCLAPLQFTEEKFGQAEKTELDAHFENLLARADSTKNWTEKILRQTE
VLLQPNPSARVEEFLYEKLDRKVPSRVTNGELLAQYMSEAANELGPETPYGKTLIKVGET
EKRLGAAERDFIHSASINFLTPLRNFLEGDWRTISKERRILQNRRLDLDACKARLKKAKA
AEAKAAAEQELRVAQTEFDRQAEVTRLLLEGISSTHVNHLRCLQEFVESQATYYAQCYRH
MLDLQKQLGRFPGTFVGNTEPASSPLSSASLATAAATIPVMPTVAGMPSAGEAAISLDDV
ALPASGTRKARVLYDYEAADSSELALLADELITVYSLPGMDPDWLIGERGNRKGKVPVTY
LELLS
Download sequence
Identical sequences G3X3S6
ENSSHAP00000022331 ENSSHAP00000022331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]