SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000022357 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000022357
Domain Number 1 Region: 469-654
Classification Level Classification E-value
Superfamily ADP-ribosylation 4.22e-47
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.014
Further Details:      
 
Domain Number 2 Region: 340-425
Classification Level Classification E-value
Superfamily WWE domain 0.0000000000011
Family WWE domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000022357   Gene: ENSSHAG00000018924   Transcript: ENSSHAT00000022535
Sequence length 662
Comment pep:novel scaffold:DEVIL7.0:GL849915.1:4688219:4728718:-1 gene:ENSSHAG00000018924 transcript:ENSSHAT00000022535 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAETEAACIVQPHCPSDEFPCQVRLSEKISPVKTCFKKKQVQKRLSTGTLRTLRPILNT
LLESGSLDGVFMPVNPSGNGGSSLCQPTVNKTLGMNSPCPPVGSDVGILLPGGADVGAPI
AEAEPSSEDTEQVVPSQDHGFPSETSNGTVPDPAVGPFQDALLHAAPSDVPVSPDCAEKA
MECIPGLFQQDNYVLQYNLNTSNKLNTGLFQGKSEEASLDLVFELLNQLQYHTHQENGIE
ICMDFLQGCCVYGSDCLKHHTVLPYHWQVKRTASQTWQSVTNDSQEHLERLFCNPDNDRI
RLKYRGHEFWADLNAMSVYDTTEFDQIRRLSTPSSLTVSSNYHTVWKYFCRDHFGWREYP
ESVIRLIEETSFRGLREVRFSMLHHQYVLNIKDNYQQSVFSRRIMKKRPLLRSCLVLMPY
LQTLGGMPSLPLPSAETASSQLFCPSVVTSTNFYPETWIAMDPSQDFIQVPVSKEDKSYR
TIYNLFHKTVPEIKYRILKILRVQNQFLWEKYKRKKEYMSKKANDISRIMNERHLFHGTS
QDVVDGICKHNFDPRVCGKHATMFGQGSYFARKASYSHSFSKRSPKGVHFMFLAKVLTGR
YTVGNHNMRRPPPVNPDSITSDLYDSCVDNYFEPQIFVIFNDDQSYPYFVIQYEEVSNTV
TI
Download sequence
Identical sequences G3X3V2
ENSSHAP00000022357 ENSSHAP00000022357 XP_003766245.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]