SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TsM_000076100;OldName=augustus_5599 from Taenia solium

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TsM_000076100;OldName=augustus_5599
Domain Number 1 Region: 188-259
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000000194
Family Homodimeric domain of signal transducing histidine kinase 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TsM_000076100;OldName=augustus_5599
Sequence length 264
Sequence
FEIIVTDPEGIIFMSGRPDWLFKSIGPLTADQIARTAHTRRYAETPLIEIPVRSTQTDRG
DTLLEMDDAERTIEYLILSEEMVDAGWTVSVLQATRPARNQAYTSVLALLLLVGLGAMAI
AVFLQNRTRLAERLAAQREIKEQLEFRVAARTVELATANDKLASEVEERRATERQLRRTQ
VELVHAGKLAALGQMSAALSHEFNQPLAAVRAYAEVSGLMLDQGRERDAKAGLDRILKVV
ERMTSISKHLRNFARRPNKKLRAV
Download sequence
Identical sequences TsM_000076100;OldName=augustus_5599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]