SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TsM_000670200;OldName=maker_27562 from Taenia solium

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TsM_000670200;OldName=maker_27562
Domain Number 1 Region: 5-112
Classification Level Classification E-value
Superfamily Histone-fold 5.03e-23
Family TBP-associated factors, TAFs 0.0001
Further Details:      
 
Weak hits

Sequence:  TsM_000670200;OldName=maker_27562
Domain Number - Region: 253-373
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0207
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TsM_000670200;OldName=maker_27562
Sequence length 421
Sequence
MDYTPDISCDSQTHIANFWEMAKQEAEGLKPEQNSFKTQDLPLARIKKIMKLDDDVKTMM
ISAEAPILFAKAAELFIRELTLRAWLHTDRNRRRTLQRNDISMAVSYGDTDQFDFLIDIV
PRDEGRGHRRSQQQHTQSALQHMAGSSLVQQTQVQVVQQQQATGDDVSIKTETAGPTAAT
LVAGADGTLTTVTAGQPTVQFATVPAAAATTSGQQIQYVIQLPATNSASNGQPFQIQMLP
QQFQTASTDAVATAQVGGTLIATGGVAGTAAATGGLQLVHVVNSQTSVQHSTPSTTTAAG
APAGAPTDATNKLQTVHVQLSDLTSGTQTLLVQPTGTVVVASSAGSSDETTAASAQPSTT
LVSVDGGETYTAAQVFSTTTSAADVQTTASSEERILQSANTTPLEHVEAPQKLEEPSTDV
X
Download sequence
Identical sequences TsM_000670200;OldName=maker_27562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]