SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TsM_000751200;OldName=maker_30173 from Taenia solium

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TsM_000751200;OldName=maker_30173
Domain Number 1 Region: 81-307
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 2.17e-21
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TsM_000751200;OldName=maker_30173
Sequence length 318
Sequence
MVYRCVAVAVALLLSTSSIFASISDECRAQQTIFANASRNGHPIDFYYFKNDTKETIQLT
WAGDAIGVIILVTMSESEQGLGQSSDIYRSIDNGKTFEKITQNLGEEIYIKRENGLQTRK
IYHKMRKIYVICHDIHNRNNSLIYSTVDSGKRWKKSTLPFILNGKLKFSARDSQSNLVFT
LEGHTKSLFVSRDGGITWELVLQNVQECFWSGFNVDNKISNRGAFTLSKSEDGGRNWRVI
LENVRKIWAPEAIRSDADLEEDSGESQYEPSGRFLYAAHFVDVERSRLQLSVSDNGGNNF
RRVYLPTVVSDQVRCPAX
Download sequence
Identical sequences TsM_000751200;OldName=maker_30173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]