SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_00075T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_00075T0
Domain Number 1 Region: 241-337
Classification Level Classification E-value
Superfamily Cyclin-like 0.0000000000017
Family Transcription factor IIB (TFIIB), core domain 0.0068
Further Details:      
 
Domain Number 2 Region: 13-63
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0000000102
Family Transcriptional factor domain 0.015
Further Details:      
 
Domain Number 3 Region: 182-231
Classification Level Classification E-value
Superfamily Cyclin-like 0.000000567
Family Transcription factor IIB (TFIIB), core domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AMSG_00075T0
Sequence length 349
Comment | AMSG_00075 | Thecamonas trahens ATCC 50062 hypothetical protein (350 aa)
Sequence
MRKSADSFDIVIDRTRTCSNCKTSPANVVEDFDGGMLICRDCGMVFREAVLDYREERRSI
KSDDGNEKDHSRSTATNNTLHTSGLGTVVGKVRGRAFMTKAEKQLKKRKQEAMPAIDRLL
LQGNDCIRTYAEHLQVPPKITDIAQKQFKEFVEKMTPVGARAMGNEPPVNAVNLKPIKNK
NTNLPEYAAVALLWACRLEKVPRTLKELHKILKIKQKKIRAALKAYRNIAGLSDAAKTSH
ADYLGRYVSEVGMSHALIRVAQAAANNVKHIDELSGKRPQTISAGIIMLVATIANENISV
DRITATTGVAATTVTKTHQTMVSHQEQLLPRDFLLKYGMLPSSSTVPPQ
Download sequence
Identical sequences A0A0L0D1F0
XP_013762941.1.50528 AMSG_00075T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]