SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_00222T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_00222T0
Domain Number 1 Region: 221-279,310-391
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 3.14e-27
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.0084
Further Details:      
 
Domain Number 2 Region: 87-232
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.0000000000136
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.042
Further Details:      
 
Weak hits

Sequence:  AMSG_00222T0
Domain Number - Region: 2-34
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000186
Family Classic zinc finger, C2H2 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_00222T0
Sequence length 402
Comment | AMSG_00222 | Thecamonas trahens ATCC 50062 hypothetical protein (403 aa)
Sequence
MACDLCSKSFVRARDFRVHMKGSAHAAALAAADERAALRAAAAAALARKTKLREQLTDVA
RHYTTRLHRGLVSVPSESPAAADGLAAAVASHYATSRPRKHILRLRKALLGLAVETVAIL
FPAAELEVYGSIPLRLDSESSDIDVSIISDEDETLLLSTIADGVEALGLSSVTVARTLTA
RIPLITIADSLSSLELDLSIWKLDKLEINKVFTTYLSLDARIPPLLFAIRSWAKARNINN
AYTGTINSFGLTVLGIAFLQSSGVVPVIEELPEVEAELATAAAAGPVANASHERIAAADH
ASAATPAADEDLGSMLVAFFEWLAAFDYDAHRISIRHGGVTSKEAHKFDDDTVFVIERPR
TPYQNVTRQVSPDSLRRLVYEFRRARDILSAGGSLVQLLASD
Download sequence
Identical sequences A0A0L0D1W6
AMSG_00222T0 XP_013763083.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]