SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_00247T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_00247T0
Domain Number 1 Region: 429-534,565-702
Classification Level Classification E-value
Superfamily RNI-like 7.06e-30
Family Cyclin A/CDK2-associated p19, Skp2 0.039
Further Details:      
 
Domain Number 2 Region: 124-205
Classification Level Classification E-value
Superfamily Cap-Gly domain 2.23e-25
Family Cap-Gly domain 0.00041
Further Details:      
 
Domain Number 3 Region: 4-85
Classification Level Classification E-value
Superfamily Cap-Gly domain 1.06e-18
Family Cap-Gly domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AMSG_00247T0
Sequence length 728
Comment | AMSG_00247 | Thecamonas trahens ATCC 50062 CAP-Gly domain-containing linker protein 4 (729 aa)
Sequence
METWSVGDRVADRHGNTGSVRFVGETEFGQAGEVWVGLEMDARVGSGDGSVDGVAYFAAK
SKHAKFVRPGMISAEASTPMTPMTPQLSRTSSMASDFGTQPLSPAVRARIPPHIAQRLAA
VGLPSLPQLKQAQSKVALGSRAADRDGNLGTVRFVGFTDFAPGVWVGLELDRPRGKHSGS
VDGVPYFTAAPNCGKLVRVESVRDPADVAAKAKASSSDGGGDAGLVPVAVVTAPSNGSGS
GTDSGSDSSEQSTASTAATSSSKSTAASDSAAAASADNLDGIVVVDDSSNVDVPPSESSR
SLRPSRSVESVAPASTPPGSPPQASAAAARMFPHLRNEMPSPIARRASIASPNARHLPPR
IPASSLANVNAALNMDTALLEASKELTGPRDRMAHRLKHVADVDVPFLLAEMLDNGRLDD
SSLVPLLRPGMVSLDLRGATKLTDAAYITIASSCPHLTTLVAADSSLSDRGLAALGSHAA
SLTALDISGNETVTDSGIEALLGPGIVALARLNMAWCTQLTDAALRAFVAHMPRTSARID
FNASGCSLLTCASLARLAATAGPLLSSFVVAGMPALADAVLDALADCCPNVQHVDVSGAG
EVTSPALSRVFATGALLRDVDVARTSLDDTGLLALHRAASRLRHLDCSNTAITDQAALVV
FADLPHLRSLSIAGCASITDAPLAVLYDTAPHLRSLDIYGSQHVSIALVRKFRARGVVVI
RSKHHKRD
Download sequence
Identical sequences A0A0L0D1A0
AMSG_00247T0 XP_013763106.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]