SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_00310T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_00310T0
Domain Number 1 Region: 220-327
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000000000157
Family Second domain of FERM 0.0014
Further Details:      
 
Domain Number 2 Region: 82-165
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000155
Family First domain of FERM 0.049
Further Details:      
 
Weak hits

Sequence:  AMSG_00310T0
Domain Number - Region: 351-427
Classification Level Classification E-value
Superfamily PH domain-like 0.00125
Family Third domain of FERM 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_00310T0
Sequence length 477
Comment | AMSG_00310 | Thecamonas trahens ATCC 50062 hypothetical protein (478 aa)
Sequence
MVVRSFIVHHCSFVLPFGPSIRPSMALLPNRSLPNSDTDILSKPQPPQPPFTPAIPTDSH
SQRPHHHTTTLPHHHSSTMAASNAVTVKVHFVDGEYENLQVTEDITAGQLRDLFAIKIGM
RPADEAEMGPEFRGPECFSIWVCGDDVELELSDEDRPFEFMSGWKNLMRQYSNVLDEPWY
RAKQAKRKKGKIKEPPCKIFFRTTALLAKPYERKFPSPGNPWHPAVVDTLWKQAHQWMLN
AYYPEAKADDAVELAALYMQIKFGDYNPKLHKVNFVPMKKLIAPRLAKKKKDKEWFKLVQ
PKHAELAGKDKLICQLLYLQRVRQFKTHNATMFEAVYNYDRESMFEHPFESGVVLGVNAD
GLFMVDLLKMKYLYFYHWSQVKDWEFTQESFSCVLTESEPGEDGTYEDKTHVFFTYQGEL
LVELIEAALDDLDAEAERVERTAKAQQKEREKQKWDTIKRGNRRSQLEAAADDIPEL
Download sequence
Identical sequences A0A0L0D1V8
AMSG_00310T0 XP_013763166.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]