SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_00532T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_00532T0
Domain Number 1 Region: 193-334,366-622
Classification Level Classification E-value
Superfamily RNI-like 3.66e-58
Family 28-residue LRR 0.0033
Further Details:      
 
Weak hits

Sequence:  AMSG_00532T0
Domain Number - Region: 808-878
Classification Level Classification E-value
Superfamily Colicin E3 receptor domain 0.0418
Family Colicin E3 receptor domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AMSG_00532T0
Sequence length 951
Comment | AMSG_00532 | Thecamonas trahens ATCC 50062 myosin-I binding protein Acan125 (952 aa)
Sequence
MLHEHADNAYFVSRVALIKTKGPEPRLLVIGQKHVYMLKAGGKLSTSFSILELRAVVSPD
ETTVSLSFAQPPLIPAAIATSVNSSSVATLDIKTPAATNVITCLARAVSVIFPDKPADSG
EGVKFVVTPPTRVKKLPVDALACGNYALAMAVMSSWLGAPLREDIMWDVENLFAVNSVKD
FNVVEFDEVRDYRPLLLALKYNSWFRCFTASGPSVDKDVLKVLAVVMRTNGHLEKLNLSG
TGLKSEFAGVFEAMAANPYLAVNNLDLSGNALDQASCDALASLIVSLPHGLASLNLSGCG
LKKKTAMVIVNALKKNSHLVSSLDVLDLSGNDLSGCTAGMAAFLAQPNSIGTLKLADTGV
VIEQVLSALQRGSSSLRTLVLDNVKFGAKDAKALVRVLQGAESLKALSLAGSKVPVASLG
EIIGAIGNNPILHEFELNAAANSFGPDGGRALAEALPAVRNLSKLNVAENELGDDGVLAL
VMALTQSTCLETLVLDGNFRGKPTKSRPAAMDALCSLIESECPLTELSLAGNAKAALKAD
TLIFLDALGANTSLTKLDISGNQMGDRGAAALSKALQLNDTLRSLSWDENGTSQVGLQHF
KTGLSRNYSIKAMPLPLIDINASLRDPEQVYALVNEIQASLFRNQNPNQFRASATGLTGV
SSLNMVRAEEFSRIVQRIRATGSGADLESHSAAIADAEATPAAQTELAFAAQSMVATMEV
DLKNMLDEFASQVREYYADRARDMQARLGELFAARLPSVADTRDELVASLADHTALVQVE
ELSKLFRGVTSELVNLGGETCASMVDIAAEHVFQAVEMRLQDALDDIEGVRAANRAAAKA
AQQDAAAAKAAKAAKDKKKKEKKVKDKDKKKDKVKSKDKVKSKDKVKDKVKGKSKDKGKA
EVPDGPDVKLEEFERKEAALEHKNRARVAAAPKRNRRPPSRRPRNRGGPSA
Download sequence
Identical sequences A0A0L0D941
XP_013762806.1.50528 AMSG_00532T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]