SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_00534T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_00534T0
Domain Number 1 Region: 7-559
Classification Level Classification E-value
Superfamily SIS domain 1.97e-166
Family Phosphoglucose isomerase, PGI 0.000000000905
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_00534T0
Sequence length 561
Comment | AMSG_00534 | Thecamonas trahens ATCC 50062 glucose-6-phosphate isomerase (562 aa)
Sequence
MTSTTAWTSEAWKALAEHKAEVSPPTFSVAAALADDDGRLDKLCVAFPDSATADATGDAE
EDVAGIGLLADFSKHLVTERTVELFGELAAAMDFNALRAAMFAGEHVNVTEDRAVGHVAL
RTPEAYKCLYDDGASSSFDFAEDGAEAVGTVLAQMKAFADSVRSGTWKGATGKAIASVVN
IGIGGSDLGPAMVVGALAPYAKDELDMHFVANVDPSNLTEALAKCDRETTLFIVCSKTFT
TAETLANANAAKAWLLDPAGGLDDAAVAAHFVAVSTNSDGVAGFGIDPANMFAFSDWVGG
RYSVWGPIGLSVMLAVGPEAFGRFLAGAHAVDEHFLTAPLASNIPFLMGTLDLWYTNFFG
YTSHAVLPYDHNLGRFAAYLQQLTMESLGKGVTRDGVPLPPHLVTSGSVVFGEPGTPAQH
SFMQLLHQGQVVPADFLVAASSHAAIGTQHEMLVANAVAQAEALMVGKSHDDPARAFSGN
RPTTTFMYRKLTPATLGALIAFYEHAVFTVAALLGLNAYDQFGVELGKKLASAIVDDFAA
ASTDGHDVSTARIMQHYLALR
Download sequence
Identical sequences A0A0L0D8P9
AMSG_00534T0 XP_013762808.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]