SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_00556T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_00556T0
Domain Number 1 Region: 7-334
Classification Level Classification E-value
Superfamily RNI-like 9.42e-39
Family 28-residue LRR 0.043
Further Details:      
 
Weak hits

Sequence:  AMSG_00556T0
Domain Number - Region: 405-421,490-561
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000199
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_00556T0
Sequence length 614
Comment | AMSG_00556 | Thecamonas trahens ATCC 50062 hypothetical protein (615 aa)
Sequence
MQSLDLLNLPNNPGLTGTFEHIAALPKLQVLHTYGSGIRGDLPVFASTELELLAISNQEL
TGTIPPQWGLLSKMTQLWMAGNMVSGPIPATLANWTALTLWDTRDNVLSGTLPPELGAGW
SKLVRFKVDNNRLSGELPRGFNSLVQLDVSGNMFTGSLDIMCDSPALDSVDAANNALYAF
PDSCALTSTSLDLSSNNFAGQLPAGIGNVAGLKHLSLASNSLSIGPVPLSWANLEPSLIS
LDLSHNAIAADVTSFLVPFRTFSALQRIDISHNKLFGEMLSSLFLEVFPVPRNFLQPLVS
LYINNNQISGNVPEWVDLLPSILEFDGSANNFTGSVDRLTGYVQSVVLSDTPGLGEADGA
SLPPNLVPVEPFSQHRIDKPYSCPAFVDVRMLRSSVVLDPAYYGYHLCRCFSGFHGSAGK
CHSCEPYGSAVRCEGGRVELPAAPIQDERIGRGLGTASLASIATTDTAAPTESSSDAGPY
WGGAEVHPGTITIQPNYYVAGKTASGMFLLDECYPIGVRETSCNPQGLDEYTCREGYRGR
VCSRCETGYYLQGRRCEVCPSALPVVLAVVYTVTFLAWFGVNQTRRKSVFTRRWSSRSSS
FCRCLRSCSPARRL
Download sequence
Identical sequences A0A0L0DBU7
XP_013762829.1.50528 AMSG_00556T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]