SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_00632T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_00632T0
Domain Number 1 Region: 1941-2344
Classification Level Classification E-value
Superfamily RNI-like 1.96e-64
Family 28-residue LRR 0.007
Further Details:      
 
Weak hits

Sequence:  AMSG_00632T0
Domain Number - Region: 1771-1865
Classification Level Classification E-value
Superfamily RNI-like 0.000314
Family 28-residue LRR 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_00632T0
Sequence length 2430
Comment | AMSG_00632 | Thecamonas trahens ATCC 50062 ribonuclease inhibitor (2431 aa)
Sequence
MRGQPVAEDDAEDVKAAAFSLTKGELAALGVGGGDDEDDDEDTSLLSSRMLNQGLPTLPE
SSSHMLFKSVSSSSLMSSTQALPSKLLVDAPELDMGSELNSPHDSDSEVTNSEVSDVASG
LGGLSLTLATPQAAMLEKARLIRVDEAKSAAANETIFHSLFDQFQALAHQLPGSHSLVVS
MVKGDIDGLGPNEAFSSTFSPLIAAAQLLQAVVGLGCHLLTSTGRAAAEPERVAITAAIQ
TVLTPEIEGAGVVHMLNKVLRRVEPAANNIVLSLVVGVVVAIVKSLQLANLRSQHKEFVT
SVLKEHNALHDADWRGAASLLAALNKALPAPPDGWVASQDAHALRSVKSSASLATLTLET
TPRKRHISLSAPADAAGGAVLGLSTSPGAGVNLVRPIAQYLEEMETLIHNLCSLHSLSSP
APEPSWGALLRSAFGIPLSQEDAIESKDNAITVMRFYMTHKQLSFLRDYTTATQLETLQL
AFKAASATSTSSDAFLETLSATTGAASILFHGHADVSTAQLFAEAIQQCLCRRMQPPSPL
VSMFSGVMEALHTRSAGSRDSCNKLSAAALVVRDELFDLPWINQSRALQGLAAELACKVE
AAAPGSLPLPAFKAFTHEVIQVLSALCEDVRILMGPPPFSAPFMVVGLDELALGLVNHST
ALTVGVIYEAASSNTEYSAALSSSTGDVDAPGVPSYSEVLGEYFARFLALLKMKLEAACV
TLGSSIRLGIKATSVSSSSVLVGTIDSISDAIRTLTGHVRDDPLAAQLALLCDAVPVFAT
KHAATLLPRLNAAIGAVLNGAHQLLGGRVRDVLAHAVLRAGRHTFSPVLFESSSHALDVG
VHLAALPAAVIRGLTLRFGVEQPYSTQGPRIVGGSALDLGEPSSPVGEPLPMLVDAGRGA
KAASGGAVGLFDVASRLRTMEDKTLISAGNSGLIYSILVFAATLTAKAGLHSRTVGQTLV
YETQSEKDTSAQAVVSADGSVHITPASYVLASSTQEQLECVFHTQLLPLFLTTSDFLVRE
RKAGYGVPWQSDDGTPLLSSLPPAEGMLDNSRHVAGHIAFALAPATQANDVLSLVGSIEH
ALHDFVHVFPLHIPAAVAYPRAASLQAQVAEDAQVLAGEYGELNHELLTQACACETHLDE
ASDVKAPEMLRKALGEFTDLLLEWAVKAPHMPGNIAPSLAKAPLLLTEVKQLNKWQHALS
EFRKLSCFDGLAADMTAIEHSLGELSKIYFSLLDMFELARETGDNDEVETVVAKHLAPPT
VFKGALSGVRVLKNEWTDKVFGSEGFLNTVADGVRRVNNALGSVYLKNSPELPGNEYAVG
LLSHLIMGVNACAPITELLKVSHARRVYVTLASITVPGVSLEKVMRSSPAVLDAWSAVQY
SQSVLMAMLVNPEDGKPDNFVVTRDGESGAVKVVCIDNDHAFVAALTNKKGGGGSSPRRS
GSGNLSSPRNMLNARHRNSIDVTNGVGSAGDGAGAPGESGDRVFVKTILYCFDRMYDAIE
PSVVDAFLALNPGAVIESWLTALARYNQRLECMFTPDQIERSYRGGSGMRLPFFIAPKAV
KVLYSKMCRMQRELRLNRKMTHLELLATVERRLAMRYEEELKLHDKSPYARFASLTAGAY
RKIKTSLVTKTASSRISSAMVCAALPNSIAGFYANNYVPEAALEELCQVTRVREDSLVAS
ALDALYRGDVSLLADLPAVSLQEQVVAQYDWAILDARQGEASLSSSFSSSSSSSSGSSSE
SDGDAAGGARVVDVPAGASNEALADVLCTLSMRRLVIRGASCLTSGRLAAILKGSPELVV
LELYGCSGIQHGGVASMAPHLEVLRMHNMADLRDVVKPRSLPAARYFPQLREILLAGNPL
LQTIDLPRYVTGLAESLEVPNVRVRGEAFSPEMLRLLLEMRAESHSPSMEGASDPEAEAY
IRAELGDVGTSFEPSPGIITNWEVLGEALSSSTSLTRLVLKQQALEQTGVAVLAKILRSR
SVRWKHLALQECGLNDRLASELVDTLRTRAGVTPGGIRRPRGESAGSAVSGVLSILDLRY
NALGGHAARSLRNLLRATPETSRVALRELNLRYNALGDSGVQVLADALVGSRLEVLNLDR
NGVTYRGASALAAVLANPGCPLTSLSLFNNELGDAGVAVLASAGLANNQRLKSLTLRKTG
AGADAASQLGVALQANTSLTYLDLDDNGLGDRGIALLADGLFFNSGSLRELKLQFNDVGE
AGAAALFKARNGRLSLSHLDLGHNALGADGARLVAHGLLDNTALQWLSVRANGLGDVGAD
HMTMAITTSRTLIVLDMSANGISPRGAEVVAAAVESRVPGSALTELNLRDNAVGFAGMRS
LLKSSRGKPLVSWLSSSVDASVRSDGGSEDQDAATTAAMARLSLTASPSKYSVSPGIASA
NRSLDGAARLFDQGEAECSEVNHSVVVKLE
Download sequence
Identical sequences A0A0L0DDU0
XP_013762365.1.50528 AMSG_00632T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]