SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_00685T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_00685T0
Domain Number 1 Region: 793-1082
Classification Level Classification E-value
Superfamily RNI-like 1.57e-31
Family 28-residue LRR 0.054
Further Details:      
 
Domain Number 2 Region: 159-313
Classification Level Classification E-value
Superfamily TPR-like 0.000000144
Family Tetratricopeptide repeat (TPR) 0.054
Further Details:      
 
Weak hits

Sequence:  AMSG_00685T0
Domain Number - Region: 50-118,182-219
Classification Level Classification E-value
Superfamily TPR-like 0.00309
Family Tetratricopeptide repeat (TPR) 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_00685T0
Sequence length 1136
Comment | AMSG_00685 | Thecamonas trahens ATCC 50062 hypothetical protein (1137 aa)
Sequence
MAAPDNGANLSLEDQNKANLSNILQHLRNARREGNVADQVANCGFAGRHHLRRNKPREAL
PYFVEQLRLAASPLDTAWAHRAIGSTYAALGDFDKAYASHESDAAAAAGLEPVFDDPGTG
EPSCRELEEFRAAVAMGKSAQAQYDAAETAAETRAASARALAAFEAALTLARSLPAPATI
PAAEKAKHMIRVLVDLANAYAEAGRYDAGIAAAAEAVELFTSLPRRVDDGGEYCSLGSIT
YSAFGYVNRELRPEQAIVAYQKARDLASTVVFTPQGKRKKAEGALAIADIHASMGQCYMV
LRDYASAGRAFNEERNAAERVYRKDLGHPRVTVARDNYAAVQTARDYTEALPNLKERAAA
SGAIADILVYLSHLLFLGMHADARDAAAPLAEQYMAALPGPLAHVSHASGAELLDLYAAA
LSKLGLHNEVVRVRKAELTAARALDSSDRAVALALCNLGVAYDDAGASVELTEDTHVQAL
NLALQAGDLELADMVFNNLEEFYFAANPNHPRLDSLLARHKQALGLGVLSQPVPALDELC
PPRDLTPPPPPQVEAPRPKRRRPPRRGQITTGGHTNVNGVIAELADSESSSGEERPAKRA
RTPQHIAPPAGHLPRGRQSPKTRIRISTFSPSYDYPIHHAYSDDDGDVANSDVGNGGDDE
HRVEPTVGGQSSPAGPRPPPPLRVKIQFPGPNHTLLLAFDSQSPVSIREAMELAATRYRA
IHGRLPIISALFFETAQLWPDDELRHVVQIEPPPLLSARVASYTDVPLTEVYMGGSSEVR
ARLHECDNAGGARLDLSNLNLADAQVSSMLPLLARRDSLTALDLSGNILGDVTMTRLAPV
VTTLPRLSALSISSNVLGAKGLSVLCKALMAADGPPLAALDVSHNAAAVRDRPTVMSQMV
RSLGFALGASGQLSASLTSLDLSNLSLTPDFWSELAEPLARLPALVSLAAGFNVLGLGNA
LQTLLAAAAGTDSGLAALNTLRLPGLAPSFTPPFGRSATDADERAFEELGSGLELPHTLH
TLDLASNRLDGRGLAALAPLLQRAESVTALDISGNELCSLPDLLARLPPNLIRLDVRDNP
LVAGSDEVVHRTMLGMVLSSKAYPQTIVVDAGCELVTATQQALPQAERSRIVVAEL
Download sequence
Identical sequences A0A0L0DE02
XP_013762416.1.50528 AMSG_00685T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]