SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_00755T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_00755T0
Domain Number 1 Region: 325-548
Classification Level Classification E-value
Superfamily PP2C-like 1.83e-48
Family PP2C-like 0.00011
Further Details:      
 
Domain Number 2 Region: 60-220
Classification Level Classification E-value
Superfamily RNI-like 8.9e-16
Family 28-residue LRR 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AMSG_00755T0
Sequence length 552
Comment | AMSG_00755 | Thecamonas trahens ATCC 50062 protein phosphatase 1G (553 aa)
Sequence
MGQNRSRPKADNELAQEFATRFVRGWRTESKALAVPGRKELVEAVVDVLKAVPREHAVLE
LSFACIQFDPPAWTALVGAATASRGLSQLVLASNGLSARHAPALAGLVVQAPSLLQLSLE
GNRLGLDGLAQVLRVVPMARILRDLNISACVVRGECGDELVDLLVEAYAGSSTLEMVAMR
ECNVSWHGFAKLEAALDVIPQISYVDLVDNPLSGVNRERRVAFAAALERNAAVWGVVKGL
FDAMYVEIGAKRRASFAASQIRPGRSVSVVDEQPERDFAAQSVYKSLTPGQRLIGRSGTP
ATVAVAPDVPDALPNVNDPRELEASFASPALTLFAYDMQGRRQEMEDSLVTVSGFGGSEA
VDVLGVFDGHGSTEPSRYATRNLLPLLARELAQAAAGPSAGAADDSATVTTGQMRFALSS
TFVALDKLMTPWAVYSGTTGLVVARVGRALVTANAGDSRAVLGLADGSAIRLSEDHKPEL
ASEKSRIEEAGGFVEAGRVNGRLGVARALGDGLYGDAVTAQPGVTVTSLEPGVLCVILAC
DGVWDVLPCRRR
Download sequence
Identical sequences A0A0L0DE53
XP_013762484.1.50528 AMSG_00755T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]