SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_00880T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_00880T0
Domain Number 1 Region: 1196-1356
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000183
Family WD40-repeat 0.052
Further Details:      
 
Domain Number 2 Region: 939-1030
Classification Level Classification E-value
Superfamily RNI-like 0.000000863
Family Cyclin A/CDK2-associated p19, Skp2 0.038
Further Details:      
 
Domain Number 3 Region: 187-276
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.0000131
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.087
Further Details:      
 
Weak hits

Sequence:  AMSG_00880T0
Domain Number - Region: 1084-1154
Classification Level Classification E-value
Superfamily RNI-like 0.011
Family 28-residue LRR 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_00880T0
Sequence length 1501
Comment | AMSG_00880 | Thecamonas trahens ATCC 50062 hypothetical protein (1502 aa)
Sequence
MQSDKPCPSSDDISNAVNCLRSAVSAGEVAPADVTSLMPLLLAYDKRRSPTPPWALSINL
CIDVLVSARNAPPHQLIAFLAELFVDAGELMTAALLYASLPLVALSASTADLASPMNMLG
LGEDGLRETFDRLVIIASTVARVYGPDDPAVGDLVHTANVLGRASLQQLPPVESASLAMG
CVADTLQRMLARVKAEAAERAEPLSPRLTALFHHVIHLLVLPLLPTPPLEYALLGLGSMA
RSELSASSDIDCMVLVASKPTADEASWLNIFATLIELCMVAFGETQAHIGPYAVLSRPAG
FHLDEALLSPRHMQLTVTQAIERQRAELRRLATEPNADIDPIAGALRNACFVAGSRTLYG
DYIDRLAELFASPSQELGLYSLSRNCSKTHGVFAPQTSTGAFSGTAHLKPLILRPISLLA
DGCMLALAPHDAARILFTVDRLDCLSGPTLEAFPPPVARALAVIFEQAMALRDAYAPSFA
TMQALAHDAAQLLGPIAAGIDALCTSQLPPRMAAKDALGNPLLHEEALLRLALDSFSAVR
VSPAVRDDPEFEGQRAAVASGLGDGACFAGIEPQSVRLLSPEAVAALDATPAAVFALPRA
SIFWRNAQLEAVLEPAVSPLATRTYHAIHALGALALGPPTGRISDIAFAGSSPAATSVYI
VIRGQLQEYRLRLRRASAVPLTEALTATSSTVLERVTNLPHVAHAVLLSLFAGLAHCGPD
AYEIDESGLLYVGGPEPAPFNSSASLASILLASRAVLESTVPQAVHARLAALAPRAVVEA
WMSAACRDNDDLVRPAYLSVLLNRLYAAKTVAASRDVGTLALGDLAGAIDARLVDRYRAR
IASERGHTPLKVFRKVAKSLSEPTTPSVSASTASLAQIWSSMTSTSSAQADDETDTPDAR
LRALAALKVDAWIETFLEHFPWASAQLEVQVSLLNVLPQLRLRRLVLSGCTAVTSTRLST
IMAASRGSLVDLDVSGCTALDSLLWMTSKRRNWALARVNLAGCTLLGGGDVAALEAAAPH
LAWLQLSSDMDLCGTYYEVTAGSPSLVRQAVRPQIRIALDALVRPEPTPRFVTASTLAIC
RADFSKAGLHDEFGVALARVLLDKRAPHVTDVSVAGNELTAVGVLALVNAFASADDQSRL
VSVTVADNAFDVDGDADLRMLLLRMSSSLRMSGRVLDYGVQPASRAVFFGDSGMDVSMVA
DAAINPSGDRLAWLAHPGVWVATIREDDDGYGIQIPIWTRVVCRDVCAVEWLSDDVLVLG
TSGGAVGTARLDGHDPAFGCIHAGDAVTSMAVLPGERVLVGRASGVLHEVELSEVAYEAE
SLVLHSSPIHALAILPDSRVATASFDGVVGLWLRAGAGWVLLDHWRAPTGSEIGPMVATA
AGELLVALAHPTQLLAVAFEGSKPAARVVWEVDDGAEGLCVVTHLTPWAGRCVSRDGLTR
VVELDDETTNVRRAPGLLCPVRSAVRWYWLVWDCDVFGVVADGSLPRPHRQFDLCELQRS
V
Download sequence
Identical sequences A0A0L0DL04
AMSG_00880T0 XP_013762059.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]