SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_00900T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_00900T0
Domain Number 1 Region: 595-740
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.77e-31
Family 2'-5'-oligoadenylate synthetase 1, OAS1, second domain 0.09
Further Details:      
 
Domain Number 2 Region: 443-607
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 4.5e-26
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AMSG_00900T0
Sequence length 828
Comment | AMSG_00900 | Thecamonas trahens ATCC 50062 PAP-associated domain-containing protein 5 (829 aa)
Sequence
MAGGMAGRKGSGKGKAKQKAQAKSAKSAKSTKSAKSAKSAKSAKKMTRKEKMAKAREASA
GPKSKAGKKEVTTKAKSKSKSKSKSKKKKKQKPSKGQSKKNSKSNKSNNAAGRSSRSNKG
QRAGAKSKASTKKQESRAGTAIDDKPAITAESSTQAVALDQRLVINDMVPSGKPKVLRCV
YCPDAREVPLTESEAHVASAYHCERAAAFVRDVEVGLYETTRLSAFELGSSYAGLLVTVS
CKVCMVRFRLEGLLAHEASVTHQAAAPAYRAALGAGTKAGSTSSPAVVRTRTWDDMLEAP
GKAPTLEDMGFLAAPEPRVGMSFSDIFSPVLGQRAKGAAAAAVATTASTPLRQPELGLRS
GSISESASGSESASGTVPESASALGGVVAGGKGMALATSAAPAEVGELSSDSGFIALDMG
GSGASPPGTKADASEDESGSSGPSWFRGPYAGDTVSERLHEEILDFSMTMSSTPSEDEMR
AVVVSQLRDLVDVVWGGKAQLEVFGSVALGLCLPTSDIDTVVFCKDSSGELPLYRLGEAM
LGCPDFESVQIIDSAKVPIIKAVHTETKTAVDVCFNVSDGVEALSIVKGQLDQYPALKPL
VLVLKYFLAQRELNEVYRGGIGSFALTNMVVAFLQHRRPQVTTSSSLGILLVEFMEMYGM
RYNYFTVGIFTQGSGRLFDKSKHPHFRNAPRGRVKSGELFRLCIQDPNNPQNDVGSGSYA
IGKIRSAFLLAFKSLVATDSYPASGSILAAIVSDSAKTTSLRRNIARLYPGTGAKLVSRK
RMRSSDDESGSGSGPAPKRKRFIKKSARMKRKLARKRRELRMGFEPSI
Download sequence
Identical sequences A0A0L0DL33
XP_013762078.1.50528 AMSG_00900T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]