SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_01200T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_01200T0
Domain Number 1 Region: 73-174
Classification Level Classification E-value
Superfamily RNI-like 0.000000000000523
Family 28-residue LRR 0.061
Further Details:      
 
Weak hits

Sequence:  AMSG_01200T0
Domain Number - Region: 292-408
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0088
Family Protein kinases, catalytic subunit 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AMSG_01200T0
Sequence length 471
Comment | AMSG_01200 | Thecamonas trahens ATCC 50062 hypothetical protein (472 aa)
Sequence
MANPPLHPAVASLVPCHGRLALSAPVPLLGARDVAAIRAAAEPSSAPGTAPEIAPGTAPV
TELAIAYAGIDSRAVRSLLPLPMVLVSLALPDNCLGPAGGVAVADAVALAPALTALDLAG
NGLGDHGLSALLTALRVSDTLVDVCASRNRGSADLLPEMMAVAGLDSPLARLEWVDNGLA
AASAGPALAAAATPAAECGTIRRVPPATVAGPDVAGEIVVELADDAAHAPIGTLVVCDKP
RSALVASKLHQYLASSAVVSLLGPEAAAEVLAAAGDAVTAECVLAVATPFLALDSYLETG
CQPGFPLEPPGAIASGIVAAVAVLAERGVAHLRLTPSAFARYELGWRIRHLRFATLEGTP
LASGNLATVYASPGVLAAAVGGARSVVASKDAMLWQLGMVLFHLLAPDAFEAMVEAVSGA
PVMFVQSLASDAVQGVAGLPYAALPLRWRATVMGLLALEPSRRELVTPVVH
Download sequence
Identical sequences A0A0L0DN91
AMSG_01200T0 XP_013761808.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]