SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_01571T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_01571T0
Domain Number 1 Region: 689-837
Classification Level Classification E-value
Superfamily RNI-like 6.28e-18
Family Cyclin A/CDK2-associated p19, Skp2 0.065
Further Details:      
 
Domain Number 2 Region: 283-453
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000031
Family Atu3015-like 0.076
Further Details:      
 
Domain Number 3 Region: 38-144
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.000000000471
Family Toll/Interleukin receptor TIR domain 0.027
Further Details:      
 
Domain Number 4 Region: 220-310
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000949
Family Shikimate kinase (AroK) 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_01571T0
Sequence length 900
Comment | AMSG_01571 | Thecamonas trahens ATCC 50062 hypothetical protein (901 aa)
Sequence
MAASSTIAAVVAAAATAAAAAVATTQTLTAAHVPTRRPGTSESGDSWDIFICHGSCDKRM
ARSLYHRLTAMGLRVFLDVYSLDGRYCGNEEALARMARCSTVVIVLVSKYMLVTTWAVAE
AEAALDPASQCVVLPVLADAEMSHIALRRWMGTPAPAGEPHFLIQYMDSAFSALTENGSE
NMDKWAKADKDARVDLVRRLRQIGLAAYNTQDYVLDDILDDIAERARTLHADEMAVRARR
LALQSRDCAPEDVAMRRAELELRGVDRYVEPPDLAIALDRLAPGGRTLVVCGLPGSGKSE
LARAIGRASHSNVAWIPPYPGQCNLALCDALVNYFGVARNIFDDNLSLEALGGRLADKLG
RTTVAMLLIFDGVDDPTLINCLAGVVSDTSHSVVVTTTSDSMPGSGTIMLPLDVLPHVTA
SAVFRAYLPEHLQNSPCVAAAAAVVVADTHGHVMTVRMQAQTIRSESDLKVLAAEATQSV
TILSPSRRRELVCSKLFAHINIIFGRPILFAHLKILHSIVDTQLALVEKLRALAQLGLVA
LDDIEVPAIVTLHSLQSAWLAERLTMHPRWSRYMRVLVFCLAAPRFLTSVDLIDGAVVAL
NHDCSALADLEVEPSAAASVVRFAHAMLADVAAPHMVDDALLSALTELAAEAACGGADIG
AIAGELVLPHASAVTDAGLKCDALREPAFSNLVSVCLAGCVQITNEGVRVLIQRAAKQLN
SLDLAGCVEISDDLALVLAGVFKQLETLSVARCPRITDKLFNTLSHVQIWVSLTSLDVSG
CGVGVGALEFVLRDQHAPLVELYVSECPGIDTQAVDVVARYGHLLSRLDVSYCGGITLAD
LLPVLANFSAASESGDEHGKPCRVWVLGLAEGMDGSEAEAVYRKYGAILEFTSRCKYHHR
Download sequence
Identical sequences A0A0L0DRS6
AMSG_01571T0 XP_013761621.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]