SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_01683T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_01683T0
Domain Number 1 Region: 2121-2183,2238-2432
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000000000623
Family WD40-repeat 0.012
Further Details:      
 
Domain Number 2 Region: 1628-1703,1749-1799
Classification Level Classification E-value
Superfamily RNI-like 0.000000000000804
Family 28-residue LRR 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_01683T0
Sequence length 2479
Comment | AMSG_01683 | Thecamonas trahens ATCC 50062 hypothetical protein (2480 aa)
Sequence
MAMADGTGGGGGGAGACASQLQVGGHGHAGGVDDIGVEAEADGGKLDVTIADVVAGDAEE
VAVKVGNLVEVEPASEAGGTESASEAGDAAHHTELASEAGNPEPAPEAGDAAHHTELAPE
AGNPEPAPEAGDAAHHTELAPKAGNPEPAPEAGDAAHHTELASEAGNLEPAPEAGDAAHH
TELAPEAGNPEPAPEAGDAAHHTELAPEAGNPEPAPEAGYAAHHTELAREAGNPEPAPEA
GDAAHHTELAPEAGNPEPAPEAGDAAHHTELAPVAGNPEPAPEAGDAAHHTELAPEAGNP
EPAPEAGDATHTTTSATPLVTRETPLDAATLLPLVDIIHAATSAASTPGDIPWAEARGLR
ILCARLSLVDRLDQDAIIPPLADLALRLAHLHMAIHSPSEADVAEASDHCTMVIRELVAA
SHSEALAASPARTAAAFDLVDGLCGLIDSFLLPRALDTELWLPPALNYTTAAFELADKAG
LADAQVTLLTALAALYSHQATSLPPSRAYANGHKIATLYAYSAIQVADDAGLTGDNVHAA
ALAPLATTAAFMRAVAAHPLSPAGAALLDAYVSPLPAADLASLPWFVNRGTLHFMRYFVA
LLYQRFFEPRVDAARLAPRSLEAVSPVFTRKLTALLVTEGLVPASAAHGSSRQAAEDADV
TPAPPSSVDWIFSLLAAHQDQFVHVLQRDEGIHVLMRLMGGMTCALLETLIEDAMSITGP
RPAHGLSLASARSLARKCPHILSYFQATMELLELQTIGLGETPFLCFDRGQRSVLKDGFR
LDVAALSPVNTITTPGELARRQVEVACDLLGGADVDPIGHGIRSGCHVAGEPELFSDYCA
ALADVFASKLDDVLPTSNNLILQWALHNRRKDEASGMLIDNPAIAAAQDLLDQRRRDEAD
NYYHYDDDGTTKRAKRVRRALNAPVKIVTRFARSRGDGAAGDAAPMSAEELAACIRDGRQ
VQLSSEQAILPYVALRQFYAIETLKRNNTAHGVFSPGEVPLAGELFVKDNLCRFIALALD
GLALYVGIACASTQGRIAALRDAGVVHRDMARAWAKFHTFACTIRYKAHFMHGCEEESVW
YADATPPATLSQLVQLTRDDSTYLRNAVTLVLHPLSAMLSDFTTSWGESAPFAAMKHMVE
ARWAWKMDAIAEVVSDGELVGDARLSAYAAAGPQAFIGVRDGRVRRLRDEFAEELFTATG
VTQTSSHGRRNVVQVGGFHFKQNPELPGAELAVHLLAHLVFGDGTPPTDLIRVRHINDDA
DYVFQVSETVPGPILKDVLASALEVPGLDHAYFSQQVLLALITNPEDGKLDNYVVEDVVE
PGAPNGLVRRPVPIDNDHAFVAPLIAHRLSAAQARVKTVLFCMADMNLPIDPVVAANFTR
VDAESVLGHWLAELDAYHRRMETIAPPAIIDALATRRNFPTTLEIRFKPGLVFVIFNKIL
TLQSAITSMSEGEPLTLRDLLQAGEPTLAPLYATVLDNESLPSAAARFAVISSGQYKSSR
GGGLVTVTPSIQIQRNQQAYVATSLAEEKRLRRLHAPPKAGLSWRRKSARDLAREAGLVT
PIELTGELSKLVKAQAANALRDLMRGDLAAFINLRLSQFKEDVVSRVDFASLDPLRQGHL
FDAMSGTYFRKLTIQGSSLLTDTMLSAILKHCRNLTKLDVSGCEKLVTLGDLAKYASNLR
VLVASGTRVTDAVLDQVERAAPDLAVCTLSNAKWAPLRTFVAHDPRLIFARTPRTFQHGL
RMLFAFNSRHRPITHLDLRGCGLVDSQALLLVNAMSATKSIRTLNVAHNAITGDVAWDLV
FLILGSDTPGSAGPVSDGGSNAFGSAESESIRGNAVVPILGSDTPGCAEPVNDGGDAGVT
ASSGSPHGSVSECVAGESCSGKESDIDNQASDGHSDPIPPVLVPADPAVELVAVDISYNP
LTQETYDRIQTVVSRLAELPTVLADTLYRQRADDADELGPAPEPIGRVEHSMRQLVEEAN
SWWMSKRIVFEPRAQVRSKKPRRAKIGGGPGGGLLGGGETRARAVSVRHDAGVESETGSE
ISVAGDVVRETTAVPLFKLPVTYGSRAESFQVGESLEVTAMAQLECRDVVAVAVRLPPCR
CALCVEQYGHKARKFAGEHDGGVVVVFDTSTMPWTVLITLSGPGYVVTALMWKMPQRQLV
AGEGSQQSRDSAGNLFVWHLRDVIHDPRTRRVVTSLDEAEASPFGRSSVVLPTIYRPVVL
VDTRSSEPAARSEVIRGESMRRLVDIARPGLVSYPVLSLAQLDEKQIAVGRYGHNIEMWH
WNELPGDGGDSGRSKLHLGDELDGHTDAVRQVAPTACGDLVSASYDGTVRLWSRGLPLDT
ISPGIGDLYAMVVLADGRLVVGGHSGQLAVVSLKQPYDKGLESSVTRLAVAHTGTVVHLQ
QLHDGRVLSSASGKPPADSLAHLANTVCIFDVDVAATGGSADLTFSTREAIVGVIETGDG
SLQLVDRGGLVSRVDLEHT
Download sequence
Identical sequences A0A0L0DRB8
XP_013761729.1.50528 AMSG_01683T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]