SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_01794T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_01794T0
Domain Number 1 Region: 349-600
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.15e-38
Family Extended AAA-ATPase domain 0.00012
Further Details:      
 
Domain Number 2 Region: 79-305
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.74e-27
Family Extended AAA-ATPase domain 0.001
Further Details:      
 
Domain Number 3 Region: 608-781,888-934
Classification Level Classification E-value
Superfamily RNI-like 0.000000118
Family Cyclin A/CDK2-associated p19, Skp2 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AMSG_01794T0
Sequence length 1569
Comment | AMSG_01794 | Thecamonas trahens ATCC 50062 cell division cycle protein 48 (1570 aa)
Sequence
MSAALAPGSLLPLPSGRFRGWFVVVAAIETGDGISAPIARLRSLNVATAHTSAWPDPQLL
GLRPSAVLADELAVAVSALDRPRRELMAFVARAMAAPDALASSGLPAPLGALVHGLPGVG
KSFLLESFARRVWGQSRPWFKVSAPALFQTMQGATERLVSSLFATAVATAPSLLIIDELQ
ELGAPLSSGADTIEARVLAQLLLELDRLTASPAGRMVLVVGITSAPLTALEPRLRTLGRL
DTVIHVAPPTRAERGAIIDTLLGELEPLPQLVVAHGLEHVSAALLSASHGYVPADLAAAV
RALAAADAAGEAADAASAVALALAAANVRPSLLVSGVGQLVEASALPGFDSLAGVDEEEA
QLRASLVLPFAQPDAFAAAGIKPPSGILLVGPSGGGKSALVRAAAAAARVNLVVVTASDV
VSKVVGETVARIAAVFETAAAAAPCVLFFDNLENVAPRRAALHGGAPGDTPVHIDRMLAA
LLIEMDGAVARRSSGERVVVVATAHSTDALDTAVLRPGRLDVHIPVGPRTPAQLWAVFCL
ALSRIVVDFDPSILDDNTAVFAAIANLGTPASVLDAVRTAAMTALREDLNTTSVSSFTNA
HIPRLPLGLARLRLAPEAQLTELGLALLVGRLSSSLRLLDLSATGSAFSPDALALLSASV
GLRELYLPPLVLGSDGTGANGFGLLDALAPSLVVFSAPCAGLAPDILKSLGACTRLTRLV
LGSPTTSTPLPPHADLASLVLPLSLVSITLCGWSDLEHGLVNALLTAPNVGHLELVRCGF
AAPNNSATPPDSVSELVPRSVPLTLALVECSGELVLSSAIAHLRAVGSLPLRQLLPAAPL
ASLASLELFNLAPAKAAAVANNLPPLPALVRFAAAAPPAGAWEAEIGVPLVRGLAAAAPR
LCALHLARVVVSAGDIAGPFGRSPHLTAIALSECTVTLQSSPPAQAGADASVLPRLVLSL
ESCKVLPGGVPAVVGLIASRPLTLFLGPNTWFRADAAADLIRKLPATLLGRLELSLAPCH
TLSLDGFVSCNGCGHVDPSDGLPVLQVLEATLLSEFGARASALAAAQANTKATNTEADVM
AELERWRERAEAAEASAAAARAAAASATARATDLEASLNKEMLARQVAEAAPSVNAQKAH
NESEELAHGHMVRITELERDKKRLLADQIALTHSVNTASERLVLIEDILAKILAPEREAS
PELELEAGDRAGDCPAADADADADASDRGSGPGEELSLLPDYFGAGGLFAADSPLLTTTT
SAAVSRELEACMADLSLAPPPPLMQVPGKATRGKKGKKGKKGKRRKKTKGGQQQKKGTGA
KPKQAPEPKPELAKQTDAQQQLNALSLRVLGIAKELAAAAPVAATAPVFKHASRDYAASE
ALTLAGIEPSRLGSLDWAGFDRPDSHSGDDGHGWESADDDDDDVDAKMFFAPRRAVMPAA
QLSTARRSESKAEGNDTDDGGDDDTDDFMDRGDDMLALLRQQRAARRNGGTSGTAAAEVA
RTDEEEIEAMMSAQLAPIKQVLREAASQPVRAPIAPSRAPAVESTHVVEPMSGAPFRRGV
RLANLRPKP
Download sequence
Identical sequences A0A0L0DTD1
XP_013761306.1.50528 AMSG_01794T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]