SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_01841T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_01841T0
Domain Number 1 Region: 101-206
Classification Level Classification E-value
Superfamily Second domain of FERM 3.4e-18
Family Second domain of FERM 0.0013
Further Details:      
 
Weak hits

Sequence:  AMSG_01841T0
Domain Number - Region: 227-299
Classification Level Classification E-value
Superfamily PH domain-like 0.00277
Family Third domain of FERM 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_01841T0
Sequence length 500
Comment | AMSG_01841 | Thecamonas trahens ATCC 50062 hypothetical protein (501 aa)
Sequence
MAAPSRVLCRVFLANKEVKTLALEAGTTGAQLKVAVMSKLGVEERFGQLFAIFCATSKSR
TLLDDSVVVPDLLTKWADFPEETKPWIQFSLFMFATDKLLAVSDAVVNNLIFLEVATWIA
SSQCLPDSDQVASLGGLHCQALFGDFDAGRHARGFLKTRHIEDYVPSHMARDKSMDDWEE
AILAEWAKLSGLSSEAARTRYIEAASSTSLFNTVWIRPCPSPSFERKVRLGVGTQGFVVV
AHDTFAILAVFPHRKLRRWVGDANKFIIEVRVSPSLVVHEFTTTEASFINACLKTCVEQL
FADLMTQTSTPRVDNNADEAAVSSSEPDAPSKAKSKDKEKKKKKAKADGEPLPDDEAAAD
AAADAAVEPESDAPDAASAEKADGADASPPPSPKKKTVKKKAAKKKGVKKKAAKKKGVKK
KGTPKKKATGGSSAPGSVKKKKGVTKKKGVKKKGVKKKGTPKKKGTPKKKGTPKKKGTPK
KKGVKKKGVKKKVAKKKATS
Download sequence
Identical sequences A0A0L0DU66
XP_013761350.1.50528 AMSG_01841T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]