SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_01912T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_01912T0
Domain Number 1 Region: 304-526
Classification Level Classification E-value
Superfamily RNI-like 2.62e-26
Family Cyclin A/CDK2-associated p19, Skp2 0.015
Further Details:      
 
Domain Number 2 Region: 464-655
Classification Level Classification E-value
Superfamily RNI-like 3.84e-17
Family Cyclin A/CDK2-associated p19, Skp2 0.03
Further Details:      
 
Domain Number 3 Region: 2-34
Classification Level Classification E-value
Superfamily F-box domain 0.00000196
Family F-box domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_01912T0
Sequence length 670
Comment | AMSG_01912 | Thecamonas trahens ATCC 50062 hypothetical protein (671 aa)
Sequence
MVLPDQLFIHIFGMLDGPALAAVARTCTLWRAAATYVALEGRIQLPSRLWILTEELLQMY
VTRDVELDVVRVTPGNNPLATYALEKKAMGWSGPLDSLAEAENSRQMELDGSKLELRHPY
TAVESGSSSTTDDEEHEEAEASGEAASAASTLSDSSVLSASRTGDACMSHSSLSTSSLSS
ASSSSSSEGWSPSWWKTDPPTRLALQGATLMDTAELLTLLEGVVASLASLEVLDLSRLNV
YVADATGEAFGLSPEDRRPQRELTMHGGPLSMSATSLLSDEVAATRDYSMLNTYRLTEPA
GVASLLPLVASLSSLTELNLTRCLGVTEVTLAVVLSNMSRLRVLRAATCLEVVGGFTLDG
AATPELEILDVSHCYDLTFVSMRAPLTRLRELHMVATHVPEIDLLAMFKGMPRLEVVNLA
RVAGVSNKAVFAMAVAAGSRLRKLHLDGATSITTLACRHLASQCDGIRWLSLNACPLVEF
TGVEEVFDGMPELETLDVGSCVGFVGDVAVMAPASLRTLNLSHCVNARFVTVSGRSLRKL
LFRSNELSKKFSINLKTPVLEELDLTLAAPCTDARLLAIGGRCPNLRTLIISSTRFSSLG
SFLFAYQKLRRLDINQCFQCSDESLWAVARWCEKLEVLSMWGLDQRISEITVAEVRQTLP
ELRIVRSAFD
Download sequence
Identical sequences A0A0L0DVV1
XP_013761413.1.50528 AMSG_01912T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]