SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_01954T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_01954T0
Domain Number 1 Region: 219-333
Classification Level Classification E-value
Superfamily Second domain of FERM 9.42e-25
Family Second domain of FERM 0.0001
Further Details:      
 
Domain Number 2 Region: 2290-2461
Classification Level Classification E-value
Superfamily I/LWEQ domain 3.14e-17
Family I/LWEQ domain 0.0015
Further Details:      
 
Domain Number 3 Region: 334-431
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000221
Family Third domain of FERM 0.0004
Further Details:      
 
Weak hits

Sequence:  AMSG_01954T0
Domain Number - Region: 118-172
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000227
Family UBX domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_01954T0
Sequence length 2527
Comment | AMSG_01954 | Thecamonas trahens ATCC 50062 hypothetical protein (2528 aa)
Sequence
MSSGIAGGLGMGINEAIFDYHETTDNGQELTVRITMQDRDPSTRAINERTKSIKFMSSAY
GVDCVAKIAETFNMEARPDYGLYFLNKFDLTKCYWLDLTKTLRYYDVHNLDELVYKQVKQ
PLRILLMDGSRKVIMCDVSQPVASLVEVICAKQNISNPEEFSLMVAEDELTDEQRAAREK
DLKRRRKRGEPVSDDEWLKADMTLNAQGVTADTTLLLKKKFFFYDASIDTSDPQTLSLLF
EQLRDDVTSGALPVQFDEAILFAALMAQVVLGAHDPDRHRKGKIDVRPFVPIEFKKTKKL
AEKVFQAHAKLGSMSVTDAKFRFIQLARSLDTFGITVFTVQEAIRNKKGKLTKKFQPILL
GISKSHLFRLDAITKQPLEEAFALTQLRRWSPSKTSITLDYGDHKDEYYTVLTEEGQKIS
ALIAGYIDIIMNQRRDRAKEQEADELRAIEEEVIAPSRAAGVARTTSARRTMTTSSVSRP
GLSRRPAPGAAGSTTTGGQSLNKRSLDRELQSISALLAGAPVILADDLPDDLADLADDDD
AKLTSLQDARDMLADILGDLALSGNDMIAAKGSSHDAVLTSAQRMQMLADELVTAAGTTA
ALLGAPEEMSDALANMQMRLAGVVAAAANDDDPEALADASRGLGAAIDSMLAAAAIPDAS
LLCMDDLLAAAGDLSSALGGMVGLNVSDKVDDPEAKAKLAAAEANVKALSDAMTNSVSMA
GARVLDDKVQAALDVQQTQLQASIVDMLTLADVSGIDLADMDSLKAAAESLNDALLKLSE
SVADADEHIDRTADIAAASVALDTTIVGVVNAESRSQALAGAKTVSAEAAALGELAALEA
TSEVNPELKDELNQLSQNLASALEAFAAATANASTDKSEAATEALKDAALGVGDAARALR
AAREQKRALTDLAKATKASVVANNTLLDELDAAGESSSPAMLKKTAGLQTKVQAPNEAAG
KAAQLYLADPTSRSAQKELLESSKALLHPVSRLVVSAKSSSSGYVDPTDQEAVANSASKA
GEKTALLKSAFGEAQGVCWDLDVEAALDRIQGVQGDLATAAASAADGSLPEKEFFENESA
ALAEMSFAMEALSSAAAVLVAAMTNLNPQDVGAAAGNAASNAAILASAVVTAQKCKEDAA
ARSNPVALERASDVAGAMADLLTAAEARHKSSSDSTAADAETAAAVAAFKDALAAMMATI
PGVGACIRAEDAVASAGAAFDLASLPPLAGPLTDAMTDDLLAAARALSDALALLNHGAKS
GSNSELERGADDLTVAFDALKTAAGTLAAALPTDGARVPLVTAVKAVAEAAAASARDARS
LAHDADDEEAAGAAAASADASAAAVAELLAVAESASDGAATEFDAIIDALLATVEAKLKT
ESGATPSGASYPAALESLATSKATIADAVKALMETTKIASAPGQDALMAVAEPLPGALAS
LAAAIVDAAAALSSEGGESGASSSGSSSTTSGGLEPATAASIEKKGTAITGGVKALSKAA
AGKPKAALKGAAALIKLANTLAVVAKDADESLVSHSKTLKAASSKLSKAAAKAAKSLSSG
GEVDVAPVVAAASLLGAATRAVLKAANKVGSGSDGAGASSASGSGNALSPEGAALVKSAR
VTAEQLVAHVSAVKAWANKPKSAPAKSLVKSSGRKTGAALTKLEKKAQSAAPGQAELAAA
GSAVDAAIESLEECSMAASVGDLTTSSKLTFATAKKRISDAIEALAEASGSLSGESEAMA
AGANSVGAGATQLAKLVAAAAAAVTDEPDDCSAILAAGVAFTSELRAAIDAAGTGGDASA
GVEAAGAALVDALATAGANAEGTSASGSSGADAVAHARDAILAAAEPAKDRGMTYKDYQS
DIKSQGKKLGKEVPKRIMVAVDEVATLYAPLMASVAAAATSSSAPDELRAAGRALCDASI
KLFEEAAELKSSPKDKALQAKVAKSASSKVAKTIAALLAAAKAEASAEKDAEEAAIAIEE
ALGELDTMSFMVTSGSLAAAEGTTYADHEAAVAKAGTKVGKALLKVEAASAGGDTGEATK
GLAESVSKLLASLEAGVPALADLSAQQALLDAAKALTEALAAFATSSLELASDPQSTEAA
AAAAEAKAASTKELKRFLKVNAKVEELATSGKRQVTTAIELAKQAVESLDADHKAGDKDD
GTLEELEAAAAGVSGAVTKFVVTARKGQKPAGEAASALVRALVGFVMAGKAIGPGVENEI
RAPFVAAMKELGADVIKALKVVKAAGGTTKKSATAHKALRKEGAKVAEDVAEVLATGLVV
SNPELAGEGSADAMAAKELKSTAKDIENSGLKKLNRLRPVRGEDGLMSFEEQLVEGCKTI
MVAAAGLIKAAAMCQKEVMAHQAAGEGGEGSMWHTDTDFSTGLISAAQRVNAECKLLVTT
AETTVKDKPENPALRIKAAVKGITASTAHLVVAAQVKAGDSKPQKLLKKAGGDVKRTAEA
LDSIATLSSAAAAAAAGGDDDDELDDEGQVAANKADMEARLRVLAAQQELEKARQAVLKR
NKRKYKK
Download sequence
Identical sequences A0A0L0DTV5
AMSG_01954T0 XP_013761452.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]