SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_01989T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_01989T0
Domain Number 1 Region: 5-131
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 5.89e-21
Family GrpB-like 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_01989T0
Sequence length 137
Comment | AMSG_01989 | Thecamonas trahens ATCC 50062 glutamate-rich protein grpB (138 aa)
Sequence
MADGMRLEHIGSTAVPGIPAKPVIDVLCVVPFASLAEVDEIVVPHFPHAGWFTSPEYNAM
LGERRYFRAWDAAGAAHRAHLHVVPHVSEQGNQFLLAAEYAELKIALAEAHSHDRSTYTA
RKAVFVGNVVQSVAGAM
Download sequence
Identical sequences A0A0L0DUR6
XP_013761022.1.50528 AMSG_01989T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]