SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_02072T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_02072T0
Domain Number 1 Region: 395-583
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 2.19e-45
Family DNA polymerase beta-like 0.0000179
Further Details:      
 
Domain Number 2 Region: 254-331
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 3.27e-18
Family DNA polymerase beta, N-terminal domain-like 0.00021
Further Details:      
 
Domain Number 3 Region: 5-107
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.24e-17
Family PARP-type zinc finger 0.00055
Further Details:      
 
Domain Number 4 Region: 338-393
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 0.00000000736
Family DNA polymerase beta-like, second domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_02072T0
Sequence length 595
Comment | AMSG_02072 | Thecamonas trahens ATCC 50062 DNA polymerase beta (596 aa)
Sequence
MADNVAYTVEYARTGRAGCKLRTKSRKCPVGKIDKGVLRIGRVKPSFMSDDDDAVFTEWF
HVPCWFDVQSRMRATSRKVESTDDLDGFEALTDADKALIGQYIDKRRSIDNDMAALASAR
PPPQPAAAAKRPLAEPVAAPPAKRQRPLADAGDLAAAALAAGKRICRYGASCYRENPDHL
RDYWHPPGSRADGLTPQPQPAVPVVHALPPPLPASVPGSGIDMAAAAGIEASIAAKTSAF
TGTASAPLIELKLHGNYNADITDLLEELGKIEKNKGNVNKHKAYMQAATSLQMLPRRVTS
GADAKSLDGVGTKIAAKIDEILATGKLGSLERAKADKQLVALSEVCKVDGIGPVLARKLV
YERGVMSLSDLAPHVDSFTTYQRAGLKYFDEFRQRIPRLEVEELERIAFSVLPSIDIRLR
ATVCGSYRRGAATCGDIDVLLTHPDWTSSRKGQPPFLAAWVAQLKAIGFLTDELGLGSHK
YTGVCILPESSPLAPPRLHRRIDILWVPYDHFYFGLLYFTGSGFFNIQMRRIALDLGYTL
NEHGMMPIDKETGAVIGDSVKVNSEEDIFRLLNMAYKSPPERDLASHWKPTMPGS
Download sequence
Identical sequences A0A0L0DV30
AMSG_02072T0 XP_013761104.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]