SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_02192T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_02192T0
Domain Number 1 Region: 290-633
Classification Level Classification E-value
Superfamily RNI-like 3.14e-42
Family 28-residue LRR 0.026
Further Details:      
 
Domain Number 2 Region: 120-334
Classification Level Classification E-value
Superfamily RNI-like 1.18e-40
Family Cyclin A/CDK2-associated p19, Skp2 0.047
Further Details:      
 
Weak hits

Sequence:  AMSG_02192T0
Domain Number - Region: 62-112
Classification Level Classification E-value
Superfamily RNI-like 0.00824
Family 28-residue LRR 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AMSG_02192T0
Sequence length 640
Comment | AMSG_02192 | Thecamonas trahens ATCC 50062 F-box/LRR-repeat protein 3 (641 aa)
Sequence
MAAERPVASLRGRQVSDDDVAGLLGKYPDKVALVNTLAVTDTSLATVARLAREAAMEGDG
STFWKLHSLHVEGSKVSDVGLNLLARAPLPVLSELSIAWASRVTDKGISSLVSWEPKPDK
LTSLSLAGCTKITDAGLIDVVDAFPNLTALDLTACRNITDSGLSALAARGAVRLRRLVLR
GCASVSDEGVCNVIRAAGSLTKLDLHGCRKISDAVATALKSYTPRLGELVLDGCVRLTDA
TPAALAAGCPRLTALDLSGLRHLTDAGLASLAGKTKALAQLSLRWCPGVTDDGLSALVRA
SPKLTSLHIPGCTRVGDATLCALGSAAPRLQHLDGVCNVIRAAGSLTKLDLHGCRKISDA
VATALKSYTPRLGELVLDGCVRLTDATPAALAAGCPRLTALDLSGLRHLTDAGLASLAGK
TKALAQLSLRWCAGVTDDGLSALVRASPKLTSLHIPGCTRVGDATLCALGSAAIKEFYRL
FLARAPLPVLSELSIAWASRVTDKGISSLVSWEPKPDKLTSLSLAGCTKITDAGLIDVVD
AFPNLTALDLTACRNITDSGLSALAARGAVRLRRLVLRGCASVSDESVCNVIRAAGSLTK
LDLHGCRKISDAVATALKSYTPRLGELVLDGCRWRLTALD
Download sequence
Identical sequences A0A0L0DVI0
AMSG_02192T0 XP_013761213.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]