SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_02194T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_02194T0
Domain Number 1 Region: 237-484
Classification Level Classification E-value
Superfamily RNI-like 7.46e-47
Family 28-residue LRR 0.024
Further Details:      
 
Domain Number 2 Region: 76-312
Classification Level Classification E-value
Superfamily RNI-like 1.26e-41
Family Cyclin A/CDK2-associated p19, Skp2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_02194T0
Sequence length 505
Comment | AMSG_02194 | Thecamonas trahens ATCC 50062 EIN3-binding F-box protein 2 (506 aa)
Sequence
MPAEQANAYRSSNENYPDKVALVNTLAVTDTSLATVARLAREAAMEGDGSTFWKLHSLHV
EGSKVSDVGLNLLARAPLPVLSELSIAWASRVTDKGISSLVSWEPKPDKLTSLSLAGCTK
ITDAGLIDVVDAFPNLTALDLTACRNITDSGLSALAARGAVRLRRLVLRGCASVSDESVC
NVIRAAGSLTKLDLHGCRKISDAVATALKSYTPRLGELVLDGCVRLTDATPAALAADCPR
LTALDLSGLRHLTDAGLASLAGKTKALAQLSLRWCPGVTDDGLSALVRASPKLTSLHIPG
CTRVGDATLCALGSAAPRLQHLDVQRCEGATDAGLAAVAAGCPDLASVSIAECQIGPEGL
AALAREVSKLRSLTIVGCTAATDDAVVALVAASPGLVELDVSKCPALTDEVVDAVAGSCH
LLERLRLADCFVTDTPLADLARSCTALRTLDLSRTAITGDGLLALAGHPALAELLITGCD
LLDPDEPKAKLISESPIDGFCVLGP
Download sequence
Identical sequences A0A0L0DV56
XP_013761215.1.50528 AMSG_02194T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]