SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_02301T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_02301T0
Domain Number 1 Region: 28-253
Classification Level Classification E-value
Superfamily RNI-like 1.16e-37
Family 28-residue LRR 0.0054
Further Details:      
 
Domain Number 2 Region: 875-969
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000244
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AMSG_02301T0
Sequence length 1533
Comment | AMSG_02301 | Thecamonas trahens ATCC 50062 hypothetical protein (1534 aa)
Sequence
MAIGLTAAGLDDALAYDDASGGFIHLLARSAPAVQWLSLAGNALTQAAPIVSALSSLHTL
SLRLNVIDDAGLAALGDVLPSSRIAILSLALNAFTANGLAHFARNALPNCRSLVSLDLSG
NVVDAAAASALGSAILSLSSLAALSLAACGLDSLAALHLAAILPAARSLLHLNLASNTLS
DEGCQFLATALARPVALTHLDLSYNAVSDSGGHALAAPLASVVSAPALAHLSLRGNGIGF
SAALALVRSVASAPLDGVLRTQIDLAGNGFSSANIDSLLLAAGPRREDILLIHDPGTAVP
QPGTSLPSGSAYATSGTSGLGPTTAPHRPHPLSLNLATHLATKRRLNLDALLAAPFVPEP
PEPTLRKLQLEGSSVEASYPSDALPNVHPWHVGSQVPGFSRMSPFASPIRGPDGTLVPPP
QWEPHYVASLHRSARSADRLSLDAHAYALELTPSHSHLTATDAVSATGKDGDESDVVRLG
HGPLPRVMELEGQFPLSLLALLDLTSAPRLLATVLEQHRQAKAQLGTVVEYKTVAWPAPE
RRTSIATPPPLLASLNATKLRLNLSSTDFLNTSVPVKRMAPELRQRRPSGPTTAKLATLA
AALKAAQESDSEVSPSTLAEWSVQLDDVVASSAPVISPGSRFLTGEVSPPATPLSTAVAA
RLAAMSYDLNSSFESMSIELDKSTEALKLDALHSTPPPAVASVGRTPTTRHQRTFAIRSQ
TRSVTDIHSASSTSSSSESHSQSSDSNTGYVEVVSPFSHSMQQVAVDDRPTPSPQNVTPA
PAHGSPEMQMLSPEQACDSPIRSLSLASELSEFEPSASSGSQTSSSRCNVDTPLAFLPTI
KLQVASSIGELGASAELAYKDDLAGPIGTYAKVTNRHNKSWCKRWVYLDPSTGTLTLFKK
QKHKAHVDRLFLTDNNEWTLIRDRSKMRKRKMTWPTLLLGSPRIGKRYWFKFGSADETEH
WAAAITGILNATILASLAADAFLMDSDPSLGSSNNNLDDADDAAADCGDHVSGGTDSEKL
SSAMECSHQLIMAHLDRQNNSHDFVDESQESGSDSGPRHVVMASNDLLHHDSAISFGSPP
SVHYAPLTPSDVVEHDDATGSADPGSALPRTMSRAETQSMSQSTSFATDRGSGDDPTASS
DGEIEPPEHSSMPAPATGSKLEPPSIVARKPHMTLSMLKRPSLTFSSSSRTATPSNLQVT
TGPDASVSSRLKSPQVPRLPDLSNLPGDAESDNESNSNSGSAGSRDEHPAAGLPHAGIGI
EIDHGDVGSLGSYRRRSSHHSRSQRLNARASPRTPSRNVLMKYSLTPKGGTNSPRDSPRA
SASDDIQRSMPWLSLVTAADVLALADLQSNRLAEVPVSLVVDNGSTPRSGYLLVLDLHAR
SVSLVRKRRMRKNTVLASWLLIQTRTLPRTVDNDSFTLEKAAVDAPMSALSPPFASDAGA
DAYVLAAKDESRVRILALFDAFRRTARGSPECKVLMGKTCRVAYAIQGSELYKHARGALV
HVDKIICGGWLRITDSRRDTSYLHAVTLRAIHD
Download sequence
Identical sequences A0A0L0DW73
AMSG_02301T0 XP_013760848.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]