SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_02386T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_02386T0
Domain Number 1 Region: 419-538
Classification Level Classification E-value
Superfamily RNI-like 0.000000000569
Family Cyclin A/CDK2-associated p19, Skp2 0.09
Further Details:      
 
Domain Number 2 Region: 28-69
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000036
Family PHD domain 0.028
Further Details:      
 
Domain Number 3 Region: 354-398
Classification Level Classification E-value
Superfamily F-box domain 0.0000589
Family F-box domain 0.0086
Further Details:      
 
Weak hits

Sequence:  AMSG_02386T0
Domain Number - Region: 624-683
Classification Level Classification E-value
Superfamily ImpE-like 0.0759
Family ImpE-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_02386T0
Sequence length 773
Comment | AMSG_02386 | Thecamonas trahens ATCC 50062 hypothetical protein (774 aa)
Sequence
MGKKTGSSSGELTDSDGAVWYARCVCGDEHSSQDRKCRKCAKSALIACDRCSHWLHLECL
HLDDDDLPENFEFVYYGHTDDDEAEAKVDADDAAAKAKDSAVATSDSEPKPAKNTIRSAF
GVRAAPPTKKSKASRGKKKSTASKSKSKSRPKSRSKASTARSRSKASKSASKASAAKRGK
GGKKAKRSRAGSRRETKVYIHRKRKRRTTKPAPAPAPALAPPPPQVNHMNPMYMANPYSM
YGYVSSPYYGFAAAAGGYYGYPHMQQYMAAQNQAAAAAAAPPPPHPAQHQDDGYYSNEYY
EYEVEYEYSNAYPSYSADDASADDAAAMEAWKPGTLAIDCRSFGELPMIKLRHEVFRLDS
LPIELLMYLFSFVPAMSKMALYAVSRGVAYAARQPEAWPVAELSFAATTLALRPLTGLAP
SLVHTKVLDLSGCALFDDTAAGMLGHVLDGFSLRRLRLVACDGFTGMGLYALATHLEGLV
ELDLSGCAGLLDVDKANAASPVAAPVTHPALMSYAHKAFVLLVAANPKLRILRLDGAQVP
PSALRYIAATSKSGTILAGLRELSVVGVPAVGPRLASALRSRFPPPAVVHVDAGGKRKLA
RPHHTGILYSKLAPQTAELYAAARQALADRDLATAERLVLEATQAAPHSGTLRTLLGRIL
VAAGEPRRADATRTLKAALAATSFVPGTAHDAPAAYYRHAAQFSPSEVDTPASFARLRRA
LSHAAHFGVGIEDVLDSMRAVNDAVRARAATATPPPPDVSDERVAMLIKHFAT
Download sequence
Identical sequences A0A0L0DW22
AMSG_02386T0 XP_013760928.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]