SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_02426T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_02426T0
Domain Number 1 Region: 70-257,287-425
Classification Level Classification E-value
Superfamily RNI-like 5.5e-33
Family 28-residue LRR 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_02426T0
Sequence length 752
Comment | AMSG_02426 | Thecamonas trahens ATCC 50062 type III effector protein (753 aa)
Sequence
MRTRRPGPPVVSPHTPMQRPHGPLAHMRDGQGVGGDGQGDGGGGGGDDDGVTDPADVLLA
STLAALTASPPPTHMDLSRLHLGAPRWAQVATALASNTGTTALDVSYNQLGTDGGLALGQ
ALAANTALVALDAGYTGLGAYGGAGLVAPLEQDNSSLRWLGLENNELGVHAGMALARALA
SNSGLTVLNVAHNELGDALHHIVNALMSNSTLLSLNLAGNLLAEDDGEPLDARPLLSGEL
ALRELDLRDVRLWDESDEAGSEHGSGSHSEPADSRGSLGPASTERLFGQPLMWLFGNSVL
TSLSLGGNAVAHSGWALAEVLANNATLSSLELDGRDCPLGSDDRGMLEAIGEALSDNAAL
TALSLPSHGLDATAGAILGAALSVNAALTALNLRNNSLGPDGGRALLGAFAHNTTLVALN
VRSNAIGAAVKAGLSEALAANIARTANHPPRPLPPRVAGTRAPLVCLEWTPLAEAPGKPV
LSSLNWLDLHPSMPAAGVVPNAGRVVVHVLVLASRAVYVGTGSRAVVAADPGAMAHVAAV
YVDASRTSTMGELTAAALAAVDDGAGARSAASAVAGMTNRVRSSARVAELERELEDAHVR
VGQLEANLRVVQAQLASQSPPPRVRVSTGAHSPALAAQLDLVTAKLQSMEKRALAAEERL
SALARLGKLSGGGSGSGSGGDHGHLPAVAQRASPAGMGGGGAGPGAGPPGGESPIRPSAR
ARLRLMVEMSNTNATKPALQPSPGSPGINGRR
Download sequence
Identical sequences A0A0L0DWA1
XP_013760967.1.50528 AMSG_02426T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]