SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_02563T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_02563T0
Domain Number 1 Region: 53-305
Classification Level Classification E-value
Superfamily RNI-like 2.75e-30
Family Cyclin A/CDK2-associated p19, Skp2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_02563T0
Sequence length 346
Comment | AMSG_02563 | Thecamonas trahens ATCC 50062 F-box/LRR-repeat protein 20 (347 aa)
Sequence
MANHLDVGPSTLYDGDNAAFVASLDSSTATEQPAAVNVAPPSHWGAPEAAVVAAACPSLK
ALRLWSISGITAPGIATAVASWPDLISFVAYSCDSFSDDDAAELAPLAQLEELNLYGCAS
VGPRGLRALTPLPSLTTLTLEYLDRITDAALIPLLSAAPGLTSLNITRCSKLTDAVLLAL
AEHAPSLTSLHVERVHGVTDAGLVALAAGCPQLTSLCTLSHAITDAGVAALAVLPLANLN
LAYSAVSDAGLAALLSGPSLCASELVEIGLTGAKAVTDAGICALASQAPQLARFNLFRLP
CVTDAGNRVVSVVNDAPSPSRAADIAAAVAAAQPIPPDTTPASTSI
Download sequence
Identical sequences A0A0L0D5B4
AMSG_02563T0 XP_013759471.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]