SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_02645T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_02645T0
Domain Number 1 Region: 141-285,326-376
Classification Level Classification E-value
Superfamily RNI-like 0.00000000000033
Family Cyclin A/CDK2-associated p19, Skp2 0.045
Further Details:      
 
Weak hits

Sequence:  AMSG_02645T0
Domain Number - Region: 47-88
Classification Level Classification E-value
Superfamily F-box domain 0.0017
Family F-box domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_02645T0
Sequence length 420
Comment | AMSG_02645 | Thecamonas trahens ATCC 50062 hypothetical protein (421 aa)
Sequence
MHFGNRNKLLTSFDIGLEQLPSIEAVEWREAEARALVADDAERIGTDGEAEWARLPTFVL
VRILAVSRKWTWLGTVAAVCKRWRRVAMLVASSCQLRLDNLLKVDSPIGMTSGAMEALFG
GNPLFANVPCVTASHMLGVKAAKLMPMLRTLQHCNMLYLSKCGINNECVQVICENMPQLR
MLAIDWSIASLEILPVISHSLRHLSRLDFSARLITVDSFETPAADLLDRIAPMPKLVDLN
LHNRFDMFRSQPSLFSKFLSRVPNLTVLDVTASISSEQLPSFKKTQSGAAVTGFAAAAGQ
VESAVPGTMLPHVGWLTPSDLRAVGRLTRLTRLRLSCANDTIVDAHLPLLASLKNLRELT
LEGADTSVEALERLAERSCPNLVTPSRRKKVKIKRGKWRRRGQGGASGSSAGPSGPSGLN
Download sequence
Identical sequences A0A0L0D6D3
XP_013759546.1.50528 AMSG_02645T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]