SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_02827T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_02827T0
Domain Number 1 Region: 321-484
Classification Level Classification E-value
Superfamily RNI-like 3.25e-36
Family 28-residue LRR 0.052
Further Details:      
 
Domain Number 2 Region: 169-295
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.09e-24
Family cAMP-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AMSG_02827T0
Sequence length 505
Comment | AMSG_02827 | Thecamonas trahens ATCC 50062 NOD3 protein (506 aa)
Sequence
MSRRVTRAQARAMAEAAKAHEAESSSSDHDEPEAEVDSHQSGAESEQSEQEAADAARAAT
AARLQALADSDSDDAPALPVTTVAGSGELDDGEVARAATAARLQALLDSDSDLDEAPAPV
PAPDQTQVSAGETHSEKGKDEDKPAASGGVFGGGGGASSDSGRLQMALQKAPQERTEDDA
DIIYQVLCEQRVLKAKSEYIRREMCRMVGYEVHAPGSPIIREGETGDKFYMILSGTVDIY
VSAAGRDPVTHMVPGQDFGEQALQQKDARRNATCTARTKCELITLNRENYTQILMLGEGH
KKTFDRVGYPNLDTEYIFTHVLLQGKHLESDGGSAIAEALKTNPRVHTVDLSGNLIGPAA
GTVLGQALSVNECVTTLNMPGTGIADEGAAALGEGLAANDVLVRLNLRNNAIGDAGVREL
ARALEANATLTTLDLSLNAITDVGARYLAESLKTNTSLVSLRLERNRISSKGKAVLNGML
RTNTGLFIDGSRPRTNHGFDPGLWA
Download sequence
Identical sequences A0A0L0D2J1
AMSG_02827T0 XP_013760668.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]